KEGG   Candidatus Methanoplasma termitum: Mpt1_c01930Help
Entry
Mpt1_c01930       CDS       T03540                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mear  Candidatus Methanoplasma termitum
Pathway
mear00220  Arginine biosynthesis
mear01100  Metabolic pathways
mear01110  Biosynthesis of secondary metabolites
mear01130  Biosynthesis of antibiotics
mear01230  Biosynthesis of amino acids
Module
mear_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mear00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mpt1_c01930 (argF)
Enzymes [BR:mear01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Mpt1_c01930 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AIZ56093
UniProt: A0A0A7LAT6
Position
202711..203625
Genome map
AA seq 304 aa AA seqDB search
MAKKDLISVVDMKEEWPGLIDLSIKLKKERGKHNAPLKGKTLIMIFEKPSTRTRISFDVA
ITELGGHALYIDASKLHMGHGETVEDTAKVMSRMAHGIMYRAYDYKVMDKFGEIATIPVI
SGLDNLEHPCQALADMVTIREKLGSFRGKKMVYLGDGNNVCNSLLYASAIMGLDMVACCP
ATRMPNAEIMLGAARIADANGSKILASHDPKEACKDADVLYTDTWISMGDETPVEKAVKI
FSMYQINSELLSIANPGCIVMHCLPAHRGFEITAEVMDGPQSVVFDQAENRLHAQKAVLY
TLLK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaggaccttatctcagtagtggatatgaaggaggagtggccgggccttata
gatctgtccatcaaactcaaaaaagaacgcggtaagcataatgcgccgctgaagggcaaa
acgctgataatgatattcgagaaacccagcacgagaacgaggatatccttcgatgttgcc
ataaccgagctcggcggccatgcgctgtacatcgacgcatcaaaactgcacatggggcac
ggggaaacggtcgaagataccgcaaaggtgatgagccgcatggcgcacgggataatgtac
cgcgcctacgactacaaagtgatggacaaatttggcgagatcgcaacgataccggtcata
agcggactcgacaacctggaacacccctgtcaggcattggcggatatggtcactatcaga
gagaagctcggctccttccgcggtaaaaaaatggtctatctgggggacggtaacaacgtc
tgcaactctctgctctacgcaagcgcgataatggggttggacatggtggcatgctgcccg
gcgacaagaatgcccaacgcggagatcatgctgggggcggcccgcatagccgatgccaat
ggaagcaagatcctggcctcgcacgacccgaaagaggcctgcaaagatgcggatgtgctc
tatacagacacttggatctcaatgggggacgaaacccccgtggagaaagcggtcaagata
ttcagcatgtatcagatcaacagcgaacttctttcgatcgcgaatcccggctgcatagtg
atgcactgtctgccggcgcacagaggtttcgagataacggcagaggtcatggacgggccg
caaagcgtggtgttcgatcaggcggagaaccgtctgcacgcacagaaagcggtgctctat
actctgctcaaatga

DBGET integrated database retrieval system