KEGG   Methanobrevibacter sp. AbM4: Abm4_0686Help
Entry
Abm4_0686         CDS       T02687                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase HemL
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
meb00860  Porphyrin and chlorophyll metabolism
meb01100  Metabolic pathways
meb01110  Biosynthesis of secondary metabolites
meb01120  Microbial metabolism in diverse environments
Module
meb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:meb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Abm4_0686 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:meb01007]
    Abm4_0686 (hemL)
Enzymes [BR:meb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Abm4_0686 (hemL)
Amino acid related enzymes [BR:meb01007]
 Aminotransferase (transaminase)
  Class III
   Abm4_0686 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 15798180
NCBI-ProteinID: AGN16579
UniProt: R9SKE4
Position
858971..860257
Genome map
AA seq 428 aa AA seqDB search
MMTSKEMFIISKDYIPGGVSSPVRAYEPYPFFVKKGHGSRIYDVDGNEYIDHCLAYGPLV
LGHANEKITHKISHQLKLGTAYGAPTEAEIKLAKEVVNRVPCAEMVRFCNSGTEATMGAI
RLARGFTGKNKIIKFEGTYHGAHDYVLVKSGSGGACLPDSIGIPKETTENTISCPFNDED
ALTKLIMENKDDIAAVIIEPVMGNIGCVAPDEGYLDFVREITKDHDILLIFDEVITGFRL
SRGGAQEYFDILPDLVTFGKILGGGFPVGAIAGRKDIMEMLAPNGPVYQAGTFSGNPITI
NAGLATMEQLTYDFYNKLNAKGQYLRESINDIVEDLDLDIQPVGLSSMFQIYFTPNEVHN
YADAQTADKDRFLVYFRQLLKNNVFIPPSQFECNFISIKHTEDDLDKTADAIENALRVAW
DLPVEDDD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttcaaaagaaatgtttattatatcaaaagattatattcctggaggggtttca
tctccagtaagagcatatgaaccttatcctttctttgttaaaaagggacatggttctaga
atttatgatgtggatggaaacgaatatattgaccattgtcttgcatatgggccattagtt
ctcggtcatgcaaatgagaaaatcacccataaaatttcacatcaattaaaattaggtacc
gcatatggggcaccaaccgaagccgagattaaacttgcaaaagaagttgtaaatagggtt
ccatgtgctgaaatggtaagattctgtaattccggtacagaagcaacaatgggagcaatt
agacttgcaagaggttttacaggtaaaaataaaataatcaaatttgagggaacttatcat
ggtgctcatgattatgtgcttgtgaaatccggttccggtggagcttgtcttccagattca
ataggtattcctaaagaaactactgaaaatacaatttcctgtccatttaatgatgaggat
gcattaaccaagcttataatggaaaataaagatgatattgcagcagttattattgaacct
gtaatgggcaatataggttgtgtagctcctgatgaaggatacttggattttgtccgtgaa
attacaaaagaccatgatattctattaatctttgatgaggtaattaccggttttagattg
tcacgtggtggagctcaggaatactttgatattttacctgatcttgtaacctttggtaag
attctaggtgggggttttccagtaggtgcaattgcaggacgtaaggatataatggaaatg
ttggctcctaatggtcctgtttatcaggcaggtactttcagtggtaatccaattacaatt
aacgcaggtcttgcaactatggaacagttaacttatgatttctataataagttaaatgct
aaaggccaatatttaagggaatctattaatgatattgtagaagatttggatttagatatt
cagcctgttggtttaagttcaatgtttcaaatttactttacacctaatgaggtccataat
tatgcagatgcacaaactgcagataaggaccgtttccttgtatactttaggcaattactt
aaaaacaatgtatttataccaccaagtcaatttgaatgtaattttatatctattaaacat
acagaagacgacttggataaaacggcagatgcaattgagaatgccttaagagttgcatgg
gatttacctgtagaagatgatgattaa

DBGET integrated database retrieval system