KEGG   Methanobrevibacter sp. AbM4: Abm4_0766Help
Entry
Abm4_0766         CDS       T02687                                 

Gene name
ubiX
Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate decarboxylase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
meb01100  Metabolic pathways
meb01110  Biosynthesis of secondary metabolites
meb01120  Microbial metabolism in diverse environments
meb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:meb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Abm4_0766 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Abm4_0766 (ubiX)
Enzymes [BR:meb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Abm4_0766 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 15798260
NCBI-ProteinID: AGN16657
UniProt: R9SIX6
Position
complement(942843..943394)
Genome map
AA seq 183 aa AA seqDB search
MIIVAITGASGVILGVRLLQALKDLDIQTGLLISDAAKTIIEYELDDVNLEDIVSLADNY
YENDDLTASVNSGSFKFDGAVIIPCSMKTLSAIANAYASNSITRVADVALKERRRLIIVP
RETPLRTTHIENMLKISKEGGIILPPIVGYYSKPKTCKDMEEFIVGKVLDSLDIDNDLYK
RWK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgataatagttgctattacaggagctagtggtgttatattaggtgtaagattacttcaa
gctcttaaagatttagatatacaaaccggactattaataagtgatgctgcaaaaacaata
atagaatatgaattagatgatgtaaatctggaagatattgtaagccttgcagataattac
tatgaaaacgatgatttaaccgcatctgtaaatagtggttcatttaagtttgatggagcc
gtaattataccatgttccatgaaaaccctatcagcaattgcaaatgcatatgcatcaaat
tccattacacgtgttgcagatgttgcccttaaagaaaggcgaagattaataattgtacct
agagaaaccccccttagaaccacacatattgaaaatatgttaaagatttctaaagaagga
ggaattatattacctccaatagtaggatattactcaaaaccaaaaacatgcaaagatatg
gaagagtttattgttggtaaagttctagactcacttgatattgataatgatctttataaa
agatggaaatag

DBGET integrated database retrieval system