KEGG   Methanobrevibacter sp. AbM4: Abm4_1048Help
Entry
Abm4_1048         CDS       T02687                                 

Gene name
glf
Definition
(GenBank) UDP-galactopyranose mutase Glf
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
meb  Methanobrevibacter sp. AbM4
Pathway
meb00052  Galactose metabolism
meb00520  Amino sugar and nucleotide sugar metabolism
meb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Abm4_1048 (glf)
   00520 Amino sugar and nucleotide sugar metabolism
    Abm4_1048 (glf)
Enzymes [BR:meb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     Abm4_1048 (glf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase Pyr_redox FAD_binding_3 FAD_oxidored FAD_binding_2 Pyr_redox_2 GDI DAO TrkA_N KR
Motif
Other DBs
NCBI-GeneID: 15798540
NCBI-ProteinID: AGN16934
UniProt: R9SLG2
Position
complement(1271632..1272732)
Genome map
AA seq 366 aa AA seqDB search
MEYDYLIVGSGLFGSVFAREMTDKGKKCLVIERRDHIGGNVYTKEDHGINVHMYGAHIFH
TDNKEVWEYVNKYADFNRFTNSPIANYKGELYNLPFNMNTFHEMWGIKTPQEAVEIIESQ
KAEANITEPKNLEEQAISLVGKDIYEKLVKGYTEKQWGRKCSELPAFIIKRLPVRLIYDN
NYFNDLYQGIPIGGYTQIIEKLLDGIYVKINCDFFDDKEKWMNVADKVIFTGMIDQFYDY
CYGELEYRGLKFETELKDTDNYQGNAVVNYTDAETPFTRIIEHKHFESAESDVTIITHEY
PQTWKRGMEAYYPVNNEANNNLFAKYQKLADKEDKVIFGGRLGLYKYYNMDKIIEEALAL
VDAESN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgattatttaatagttggttcaggactttttggttctgtatttgcacgtgaa
atgacagataaaggtaagaaatgtttagttattgaaagaagggaccatataggaggtaac
gtttacactaaggaggaccatggtataaatgttcatatgtatggtgcacatatattccac
acagacaataaagaggtctgggaatatgtaaataaatatgctgattttaaccgttttaca
aactcacctattgcaaactataagggtgaactatacaatcttcctttcaatatgaatacc
ttccatgagatgtggggaatcaaaacccctcaggaggctgttgaaattattgaatctcaa
aaggccgaggcaaatattacagaacctaagaaccttgaggaacaggctatcagtcttgta
ggtaaggatatttacgagaagttggttaagggatataccgaaaaacagtggggaaggaaa
tgtagtgaacttcctgcatttattattaaacgtttgcctgtaagactaatctatgacaat
aactatttcaacgatttataccagggaatacctattggtggatatacccagattattgaa
aagcttttggacggcatttatgttaagattaactgcgatttctttgacgataaggagaaa
tggatgaatgttgcggacaaggtgatatttaccggtatgatagaccagttctacgattac
tgttatggtgaacttgaatataggggccttaagtttgagactgaattgaaggataccgat
aactatcagggtaacgctgttgtaaactataccgatgctgaaactccatttacaagaatc
atcgaacataagcactttgaatctgccgaatcagatgtcaccatcattacccatgaatat
ccacagacctggaaaaggggcatggaggcatactatcctgtaaataacgaggcaaacaat
aacctatttgcaaaataccaaaaattagcggataaggaggacaaggttatcttcggtggt
cgtctaggtctatataaatattataatatggataagatcattgaggaggctttggctttg
gttgatgctgaaagtaattag

DBGET integrated database retrieval system