KEGG   Methylophaga frappieri: Q7C_1194Help
Entry
Q7C_1194          CDS       T02056                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mec  Methylophaga frappieri
Brite
KEGG Orthology (KO) [BR:mec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mec03009]
    Q7C_1194
Enzymes [BR:mec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Q7C_1194
Ribosome biogenesis [BR:mec03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Q7C_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AFJ02347
UniProt: I1YHF4
Position
1222119..1223096
Genome map
AA seq 325 aa AA seqDB search
MAEIIKLDTIIPDACSGLRLDQALAQLFPDFSRGQLSKWIKSGDVLLNNSQPKPRDKVNS
GDSVLIEAELAVQDNNWQAEQISLNIIYEDEQVLILNKPAGMVVHPGAGNQDGTLVNALL
AHAPGLTHIPRAGIVHRIDKNTTGLLMVAKTLPAHNSLINQLQERSVLREYQAIITGVLT
AGGTVNEPIGRHHIDRKRMAVSDSGKPSITHYRVEKRFRAHTHIRCKLETGRTHQIRVHM
AHIRHPLVGDPVYGGRFKMPKGLTDSARDALTGFRRQALHAGLLGFIHPKSGEMVSWQVP
IPDDMQTLITTLDNDNQASEQDHQL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaataatcaaactcgacacgatcattcctgatgcctgttcaggcttacgatta
gatcaagcattagcgcaacttttccctgatttttctcgtggccagcttagcaaatggatc
aaatccggcgatgtcctgttaaataacagccagccaaaaccacgcgataaagttaacagc
ggcgacagcgttctcattgaggccgagcttgccgttcaggataacaactggcaagcagaa
caaatctctctgaatatcatttatgaagatgagcaggtgctgattctcaacaagcctgca
ggcatggtggtacatcctggggcaggcaaccaggatggtacgctggtcaatgccttactt
gctcatgcgcctggtttaactcacatccctcgtgccggtatcgttcaccgcattgataaa
aataccaccggcctactcatggtcgcaaaaacattacctgcccacaatagcttgataaac
caactacaggaacgcagtgtcttacgcgaataccaggcaattatcactggcgttctcacg
gctggcggtaccgtgaatgaaccaattggccgtcaccatatcgatcgaaagcggatggca
gtaagtgatagtggcaaaccgtcaataacccattaccgcgttgaaaaacgattccgcgcc
catactcatatccgttgtaaattagaaacggggcgtacccaccaaatacgcgtacatatg
gcacatattcgccatccgttggtgggcgacccggtgtatggtggccgtttcaaaatgcca
aaaggacttaccgactcggcacgcgatgcgctaactggctttagacgccaagcccttcat
gctggcttattaggttttattcatcctaaatctggtgaaatggtcagctggcaagtcccg
attccagatgatatgcagactttaataactactttggataacgacaatcaagcttctgaa
caggatcatcaactttaa

DBGET integrated database retrieval system