KEGG   Methylophaga frappieri: Q7C_1215Help
Entry
Q7C_1215          CDS       T02056                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mec  Methylophaga frappieri
Pathway
mec00010  Glycolysis / Gluconeogenesis
mec00051  Fructose and mannose metabolism
mec00562  Inositol phosphate metabolism
mec00710  Carbon fixation in photosynthetic organisms
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01120  Microbial metabolism in diverse environments
mec01130  Biosynthesis of antibiotics
mec01200  Carbon metabolism
mec01230  Biosynthesis of amino acids
Module
mec_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7C_1215
   00051 Fructose and mannose metabolism
    Q7C_1215
   00562 Inositol phosphate metabolism
    Q7C_1215
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Q7C_1215
Enzymes [BR:mec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Q7C_1215
Exosome [BR:mec04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Q7C_1215
  Exosomal proteins of bladder cancer cells
   Q7C_1215
  Exosomal proteins of melanoma cells
   Q7C_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFJ02365
UniProt: I1YHH2
Position
complement(1241789..1242568)
Genome map
AA seq 259 aa AA seqDB search
MRKPLIAGNWKMIGTRATNQALLEAILDQRYLFKGVDVALFPPAVYLQQVQTALQGTELH
WGTQNLSQFESGAYTGEISAAMCRDFGSKYVLMGHSERRCLYAELNLDQHFLDHIIAEKY
EMALRFGLTPIVCIGESPEEHALGQTEEVVIRLLDTIIAHQGADSLQHAVLAYEPVWAIG
TGKTATPEWAQEVHSVMRKRIASHNPEVARNVQILYGGSVKGNNAGPLFAKPDVDGGLIG
GSSRDADDFVKICQAARQS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccgcttattgctggcaactggaaaatgataggtacccgagccacaaatcag
gccttgctggaagccattctggatcagcgatacttgtttaaaggggttgatgtggctttg
ttcccgccagcggtgtatttgcaacaagtgcagactgcactgcaaggcacagaattacac
tggggtacacagaacttatcccagtttgaaagcggcgcttacactggcgaaatttcggca
gcaatgtgtcgtgattttggttcaaaatatgtattgatggggcattctgagcgacgttgc
ctttatgccgagttaaatctggatcagcattttctggatcatattatcgccgaaaagtat
gaaatggccttgcgatttgggttaacgccaattgtttgtatcggtgaaagtccggaagaa
catgccttgggccaaaccgaagaagtcgtgattcgtttactagataccatcattgcccac
cagggagccgatagtttgcagcatgccgtgttggcttatgagccagtctgggcaatcgga
acgggcaagacggcgacacctgaatgggcgcaggaggtgcactctgtaatgcgcaaacgt
atcgcgtcacataacccggaagtcgctcggaatgtacaaatcctttacggcggcagcgta
aaaggtaataatgccggcccattatttgctaaacccgatgttgatggtggcttaatcggg
ggcagttcgcgtgatgcggacgatttcgttaaaatatgccaagcagcgagacaatcttag

DBGET integrated database retrieval system