KEGG   Methylophaga frappieri: Q7C_1224Help
Entry
Q7C_1224          CDS       T02056                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mec  Methylophaga frappieri
Pathway
mec00860  Porphyrin and chlorophyll metabolism
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01120  Microbial metabolism in diverse environments
Module
mec_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q7C_1224
Enzymes [BR:mec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Q7C_1224
Exosome [BR:mec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q7C_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFJ02374
UniProt: I1YHI1
Position
1252833..1253852
Genome map
AA seq 339 aa AA seqDB search
MTRQFFDLSAFPRQRPRRMRKDAFSRRLMQEHRLSSADLIYPCFVLEGEKQREAVPSMPG
VERLSLDYLLEEARQLVTLGIPMMALFPVIATEKKSLDAAEAYNSEGLIQRTVRTLKSAF
PELGIMTDVALDPYTTHGQDGLIDDDGYIVNDETVSVLIKQALSHAQAGADVVAPSDMMD
GRIGAIREALENHHYIHTRIMAYSAKYASQFYGPFRDAVGSAGNLAGGNKYSYQMDPANT
DEALHEVALDIQEGADMVMVKPGLPYLDVLYRVKTTFQKPTFVYQVSGEYAMLQAAIANG
WLNEQTILESLLSFKRAGADGILTYFAKYAAEQLRNQHD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactcggcagttttttgatttatccgcttttcccagacagcggcccagacgaatgcgc
aaagatgccttctcgcgtcggttaatgcaggagcatcgactcagcagtgctgatctgatc
tatccgtgttttgtacttgaaggagaaaaacaacgcgaggccgtcccctctatgcccggc
gttgaaagattaagtcttgactatttgttagaggaagcgcggcaattagtcaccttgggc
attccgatgatggctttattcccggttattgccactgaaaaaaaatctttagatgccgca
gaagcctacaattcagaagggctcattcaacgtacggtgcgtaccttaaaatctgccttt
cccgagttgggcatcatgacagatgttgcgctggacccctatacaacgcacggtcaagat
ggtctgattgatgatgacggctatatcgtgaatgacgaaacggttagcgtattgataaaa
caggccttatctcatgcgcaagccggtgcggatgtggttgcgccttcagatatgatggat
ggtcggattggcgccatccgagaggcattagaaaaccatcattatatccacacgcgcatc
atggcctattctgctaaatatgcctcgcaattctatggtccgtttcgtgatgccgttggc
agtgcaggtaatttagccggtggcaacaaatatagttaccaaatggatccagctaacacc
gatgaagccttgcatgaggttgccttggatattcaagaaggtgccgatatggtgatggtc
aaacccggcctgccttacttggacgttttgtatcgtgtcaaaacaaccttccaaaaaccc
acttttgtttatcaagtcagtggcgaatatgccatgctgcaagctgctatcgcgaatggt
tggcttaatgagcaaaccattttagaaagtttattaagttttaaacgtgccggtgccgat
ggtattttgacctatttcgctaaatatgcggcggaacaattgagaaaccaacatgactga

DBGET integrated database retrieval system