KEGG   Methylophaga frappieri: Q7C_1278Help
Entry
Q7C_1278          CDS       T02056                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
mec  Methylophaga frappieri
Brite
KEGG Orthology (KO) [BR:mec00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Q7C_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AFJ02428
UniProt: I1YHN5
Position
complement(1306069..1306449)
Genome map
AA seq 126 aa AA seqDB search
MTDESNQIRVAVKTTYLESESDPARSRYLFAYTITIENVGLIPARLLSRYWKITGGDGHE
QEVEGDGVVGQHPYLAPTEQFTYTSAAMLDTPVGMMQGQYTMLNDDGVRFAVDIPAFTLA
MPQTLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgaaagtaatcaaattcgggtagccgtaaaaacaacctatcttgagtctgag
tctgatccggctcggtctcgatacctatttgcctacacgattaccattgaaaatgtgggc
ttaatacccgcacgcttgctgtctcgatattggaaaatcaccggcggtgatggtcatgag
caggaggttgaaggtgatggtgtcgtgggtcaacatccttacctggcgccgacggaacag
tttacctataccagtgctgcgatgctggatacgcccgtagggatgatgcagggccagtat
acgatgctcaatgatgatggggttcgcttcgcggtggacattccagccttcacattggcc
atgccgcagacattacattaa

DBGET integrated database retrieval system