KEGG   Methylophaga frappieri: Q7C_1340Help
Entry
Q7C_1340          CDS       T02056                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mec  Methylophaga frappieri
Pathway
mec00260  Glycine, serine and threonine metabolism
mec00750  Vitamin B6 metabolism
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01120  Microbial metabolism in diverse environments
mec01230  Biosynthesis of amino acids
Module
mec_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7C_1340
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Q7C_1340
Enzymes [BR:mec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Q7C_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ02490
UniProt: I1YHU7
Position
complement(1366959..1368041)
Genome map
AA seq 360 aa AA seqDB search
MQFRPRYTGLIEHYRDRLPVNDDTRLISLGEGNTPLIKLNNIPKKIGKHVDMYIKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYASRAGITAFVLIPDGKIAQG
KLAQAMMHGATVIQIKGNFDQGMQLVKDVAQHAPVTIVNSINPYRLQGQKTAAFEIVEEL
SCAPDYHCLPVGNAGNITAHWMGYSEYYEDGIVATRPKMLGFQASGSAPFMRGHMVDDPE
TVATAIRIGHPQSWDKAWKVKEESGGWFDECTDEEILAAQKLLAEMEGIFCEPASAASVA
GALRDIKNGKIPENSKVVCTLTGHGLKDPDTAIKQSTSAVVTVNADLDSVRDAILNNMGT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaattccgaccccgttacactggtctgattgaacattatcgtgatcgtctgccggtc
aatgacgatacgcgcttgattagtcttggtgaaggcaatacaccactcattaagctcaac
aacattcccaaaaaaatcggcaaacatgtcgatatgtatattaagtacgaagggctcaat
ccaaccggatcatttaaagatcgtggtatgaccatggcggttaccaaagcggttgaagaa
ggcagtaaagccattatttgtgcatcgacgggtaatacttcagcggcggccgcagcctat
gcatcacgtgctggtatcactgcgtttgtcctgattcctgatggtaaaatcgcgcagggc
aagcttgctcaggcgatgatgcatggcgccacggtgatccagatcaaggggaactttgat
cagggtatgcaattggttaaagatgtcgctcagcatgcaccggtgactatcgttaattcg
attaacccgtatcgactacaaggtcagaaaacagccgcgtttgaaattgttgaagaatta
tcttgtgcgccagattatcactgtctgccggtcggtaatgctggcaatattaccgcgcat
tggatgggctacagcgaatattatgaagatggtattgtcgccacgcggccaaaaatgctg
ggctttcaagccagtggcagtgccccatttatgcgtggccacatggtagatgatcccgaa
acagtcgcgaccgccattcgaattggccatccgcaaagctgggacaaggcctggaaagtg
aaagaagaatcaggcggttggtttgatgagtgcaccgatgaagaaattcttgcggctcaa
aagttactagcagaaatggaaggcattttctgtgaaccggcttcggcggcttctgttgct
ggcgcattacgggatatcaagaatggcaagattccagaaaacagtaaagtggtttgtacg
ctgactggtcatggtctgaaagatcccgatacggctattaagcagagcacttctgctgtg
gtaacagtgaatgcggatctggattcggtccgtgatgcgatattgaataatatgggtacc
taa

DBGET integrated database retrieval system