KEGG   Methylophaga frappieri: Q7C_197Help
Entry
Q7C_197           CDS       T02056                                 

Definition
(GenBank) Kef-type K+ transport system, NAD-binding component
  KO
K08714  voltage-gated sodium channel
Organism
mec  Methylophaga frappieri
Brite
KEGG Orthology (KO) [BR:mec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mec02000]
    Q7C_197
Transporters [BR:mec02000]
 Other Transporters
  Pores ion channels [TC:1]
   Q7C_197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ion_trans PKD_channel DUF2973
Motif
Other DBs
NCBI-ProteinID: AFJ01378
UniProt: I1YEN5
Position
197944..198759
Genome map
AA seq 271 aa AA seqDB search
MNPSQQRAFLSFQDHFEQLRHNRLFEWSVVAVIIFSALLAGAKTYDIPVSVSRTMVWLDY
AITLFFLIEISIRFLGERRKRDFLKSGWNVFDTLIVIASLVPIEDSELAFVGRLLRIFRV
LRMVSIIPELRHLLNSLLKALPQLSYVALMMFIIVYIFAAVGTSLFADINETLWGDIAVA
MLTLFRVMTFEDWTDVMYETMAVYPLSWVFYLLFIFLNTFAFLNMLIGIVVNVMEQERQE
AQQQLHKNDPTLHDVLHELQALKELVRQQTK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttcacaacaacgcgcttttctcagtttccaagaccattttgaacaactacgt
cataaccgcctatttgaatggtcggtggtggctgtgattattttttcagccttgcttgcc
ggcgcaaaaacttatgatattccggtcagtgtatcgcggacaatggtgtggctggattat
gccattacgctgttctttttaattgagatcagtattcgatttttaggcgagcgacggaaa
cgtgactttttgaaaagcgggtggaatgtctttgataccttgattgtcattgccagtctg
gtgccaatcgaagacagtgaactcgcttttgttggccgcttattgcgcatttttcgtgta
ctgcggatggtctccatcattcctgagcttcgccatttgctgaactcattgcttaaagcc
ttgcctcagcttagttacgtggcgttgatgatgttcattattgtttatatttttgccgcc
gtgggcacatcactttttgccgatattaatgaaaccttgtggggggatattgcggtcgcg
atgctgaccttattcagggtcatgacttttgaggactggactgacgtcatgtatgaaacc
atggccgtttatccgctcagctgggtattttatttgctgtttatttttcttaataccttt
gcttttttaaatatgttgattggtattgtggtcaatgtcatggagcaagaacgtcaggaa
gcacaacaacagcttcataaaaacgatccaacactgcatgatgttttacacgaattacaa
gcccttaaagaactggttcgccagcagaccaaataa

DBGET integrated database retrieval system