KEGG   Methylophaga frappieri: Q7C_214Help
Entry
Q7C_214           CDS       T02056                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mec  Methylophaga frappieri
Pathway
mec00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mec01100  Metabolic pathways
mec01110  Biosynthesis of secondary metabolites
mec01130  Biosynthesis of antibiotics
mec01230  Biosynthesis of amino acids
Module
mec_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mec00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q7C_214
Enzymes [BR:mec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Q7C_214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS CdhD AA_kinase
Motif
Other DBs
NCBI-ProteinID: AFJ01395
UniProt: I1YEQ2
Position
211902..212702
Genome map
AA seq 266 aa AA seqDB search
MNSKPDILNKILQRKQQEIAERNGRVPLQKMQQLAEQALPVRGFVTAMQTKLAAGQSAVI
AEVKKASPSKGLLREDFHPAEIARSYQAGGAACLSVLTDRDFFQGHEDYLQQAREACDLP
VIRKDFIVDPYQVFEARAINADCILLIVAALTDAQLENLSQLALQLDMDVLVEVHDAIEL
QRALSLNLPLIGINNRDLRSFEISLQTTLALLPQIPDDVIVVTESGIHTAAHVEQMRNHD
VNAFLIGETFMRAPDPGQALKALFES
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaagcccgatattctcaacaaaattctgcaacgcaagcaacaggaaattgcc
gaacgtaacggtcgcgttccattgcaaaaaatgcagcagcttgctgagcaagccctgccc
gttcgtggctttgtcacggcaatgcaaacgaaactggcggcaggacaaagcgccgtcatt
gccgaagtaaaaaaagcctcgccaagtaaaggtctgcttcgagaagattttcacccggcg
gagattgcccgctcctatcaagcaggaggtgccgcttgtttatctgttttaacggataga
gatttttttcaaggtcacgaagactatctgcaacaggcacgggaagcttgtgacttaccc
gtgattcgaaaagactttattgttgacccatatcaagtctttgaagcaagggctatcaat
gcagactgtattttattgattgttgccgctttaaccgatgcgcagttagaaaacctcagt
caattggccttgcaactggatatggatgtcttggttgaagtccatgatgccattgagtta
caaagggcactaagcttgaatttacccctgattggcattaataaccgggatttacggagc
tttgaaatctcgctacaaacaaccttggcacttttgccgcaaatccctgatgacgtgatt
gtcgtaacagaaagtggcattcataccgcagcgcatgttgaacaaatgcgaaatcatgat
gtaaacgcttttttgatcggcgaaacttttatgcgcgccccagatccaggacaagcacta
aaagccttgttcgaatcttaa

DBGET integrated database retrieval system