KEGG   Methylophaga frappieri: Q7C_232Help
Entry
Q7C_232           CDS       T02056                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mec  Methylophaga frappieri
Pathway
mec00620  Pyruvate metabolism
mec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q7C_232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mec02000]
    Q7C_232
Enzymes [BR:mec01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Q7C_232
Transporters [BR:mec02000]
 Other transporters
  Primary active transporters [TC:3]
   Q7C_232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3 TGT
Motif
Other DBs
NCBI-ProteinID: AFJ01411
UniProt: I1YER8
Position
227148..228929
Genome map
AA seq 593 aa AA seqDB search
MSDTKNSLGITDVVLRDAHQSLFATRLRLDDMLPIADKLDNIGFWSVESWGGATFDACIR
YLGEDPWHRIRSLKAAMPKTQQQMLLRGQNLLGYRHYADDVVRKFVERAAINGVDVFRVF
DAMNDPRNLEVALKAVKETGKHAQGTMAYTISPVHDLQMWLDMAKRIEEMGADSLCIKDM
AGLLKPYKAYELVKSLKQTVTIPIHMQSHATTGLSTATIMKCVEAGIDNVDSAISSMSMT
YGHSATESVVAIFEETERDTGLNIELLEEVATYFREVRKKYAQFEGSLRGVDSRILVAQV
PGGMLTNMENQLREQNALDRMDEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVINVLTGE
RYKTITEETQALLRGEYGAAPAAFNQELQQRVLEGNQPVTCRPADNLDPELDTLTSELDS
LAAEEGFELAEGDQKIDDVLTYALFHQTALKFLRNRHNPDAFEPVPTLASAAAATAQKSA
NSPETYTINVNGQQYVVEVNEGGDIGQVASQPAAATPAATSGNDQPVKAPLSGNIWKVLV
NQGQEVNEGDVLLILEAMKMETQIVAEKAGSVTGVYVKPGDTAKVGDVLVTIG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccaaaaattcactcggcattactgatgtcgtcctgcgtgatgcgcatcaa
tctctctttgccacgcgacttcggctcgacgacatgctgcctattgctgacaaactcgac
aatattggcttctggtcagtagaaagctggggtggtgccacgtttgatgcctgcattcgt
tatttaggcgaagacccgtggcatcgtatccgcagcttgaaagcagcgatgcctaaaacc
caacaacaaatgttgcttcgcggacagaacctattaggttatcggcactacgctgatgat
gtggttcgcaaattcgtagaacgcgccgctatcaatggcgttgacgtatttcgtgtgttt
gacgcgatgaatgatccgcgcaacttggaagtcgccctgaaagccgtcaaagaaaccggc
aaacatgcccaaggcactatggcttacaccatcagcccggttcatgacttgcaaatgtgg
ctggacatggccaagcgtattgaagaaatgggcgctgattcgctctgcatcaaagatatg
gctggtttgcttaagccttataaagcttatgaactggttaaaagccttaagcaaaccgtc
actattccaatccatatgcagtctcatgcaaccacaggcttatcaaccgcaacgattatg
aaatgcgtcgaagcaggcattgataatgttgatagtgccatttcatcaatgtcgatgacc
tatggccactcagcaactgagtcggttgtcgctatttttgaagagactgagcgagataca
ggtctaaatattgagctgcttgaagaagtcgctacctacttccgtgaagttcgcaaaaaa
tacgcgcaatttgaagggtctttgcgtggcgtcgactctcgtattctggtcgcgcaggtt
ccgggcggtatgttaaccaacatggaaaaccagcttcgcgaacaaaatgccttggatcga
atggacgaagttctgaaagaaatcccacgtgtccgtgaagacctggggtttatcccgttg
gtcacgccaacctcccagatcgttggcacacaatcggtcatcaatgtgctgaccggtgaa
cgctataaaaccatcaccgaagaaacccaggctttacttcgtggtgagtacggtgcagcg
ccagcggcatttaatcaggaattgcaacaacgggtattggaaggcaatcagcctgttacc
tgccgccctgcagataatttagatccagagcttgataccttaaccagcgagcttgatagc
cttgctgcagaagaaggtttcgagttggctgaaggtgatcagaagattgatgacgtatta
acctatgccctgttccaccaaacggctttgaagttcttgagaaatcgtcacaacccagat
gcgtttgagccggtaccgacattggcctcggctgcggcggcaacggcacaaaaatcagca
aatagccctgaaacttacaccattaacgtgaatggtcaacagtatgttgttgaagtcaac
gaaggtggtgatattggtcaggtagccagtcaacccgctgctgcaacgcctgcggcgact
tctgggaatgaccagcctgtcaaggcgcccttatcgggaaatatctggaaagtccttgtc
aatcaaggtcaagaagtcaatgaaggtgatgttctgttaatccttgaagccatgaaaatg
gaaacccagattgtcgcagaaaaagcaggttcggttaccggtgtctatgttaaaccgggc
gatacggcaaaagtcggcgatgtattagtaacgattggataa

DBGET integrated database retrieval system