KEGG   Megasphaera elsdenii: MELS_2187Help
Entry
MELS_2187         CDS       T01633                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
med  Megasphaera elsdenii
Pathway
med00260  Glycine, serine and threonine metabolism
med01100  Metabolic pathways
med01110  Biosynthesis of secondary metabolites
med01120  Microbial metabolism in diverse environments
med01130  Biosynthesis of antibiotics
med01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:med00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MELS_2187
Enzymes [BR:med01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MELS_2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: CCC74404
UniProt: G0VML2
Position
2422360..2423409
Genome map
AA seq 349 aa AA seqDB search
MTTLLPFASDYMEGTYPAILEKLTAMNFTAQSGYGTDKISTSAKDKIRQACHCPDGEIYF
LNGGTQTNAIVIDALLHRYEGVLAATTGHVSIHEAGAIEYTGHKVIQLPQTQGKLLASTV
RQFMETFRADANNEHMVQPGMVYISHPTEYGTLYTKQELLALAETCRQYDLPLYVDGARL
AYALAAPENDITLADLAASCTVFYIGGTKCGALIGEAVVIPQKGRIPHFFTTIKQHGALL
AKGWLLGTQFDVLFSDGLYERIGRPAIESANVIRQALKAAGYTFYIPTVTNQIFVIMDNQ
KIEALSHTVAFSRWEPYDADHTIIRLATSWATTKKDTDSLIACLQPHDL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactactttattaccattcgcctcagactatatggaaggcacatatccggctatctta
gaaaaattgacagccatgaattttacagcccaaagcgggtacggcaccgataaaatcagt
accagcgccaaggacaaaatacgacaagcctgccactgccccgacggagaaatctatttt
ctcaacggtggtacccagaccaatgccatcgtcatcgatgccctgttacaccgctacgaa
ggtgttctcgccgccacgacgggacatgtcagcatccatgaagccggtgccatcgaatac
acggggcacaaagtcattcagctgccgcagacacaaggaaaattgctagcctccacagtc
cgacagttcatggaaacctttagggctgatgctaacaacgaacacatggtacaacccggc
atggtctatatttcccatccgacagaatatggcacgctgtacacaaaacaagaattgttg
gctttagccgaaacctgtcgccaatacgacctgccgctctacgtggacggagcccgcctg
gcctatgccctagcggccccggaaaacgatatcaccctggccgatttagccgcatcctgt
acagtcttctatattggcggaacaaaatgtggtgccctcatcggagaagctgtcgtcatc
cctcaaaagggacggattcctcacttctttacaaccatcaaacaacacggcgccttgctg
gctaagggctggctgttgggtacacaattcgatgtcttgttcagcgacggcctctacgaa
cgaatcgggcgtccagccattgaaagcgccaatgtcatccgccaggctttgaaagcagcc
ggatatactttctatatccccaccgtgaccaatcaaattttcgtcatcatggacaaccaa
aaaatcgaggcgttaagccataccgtcgccttcagccgctgggaaccctacgatgccgac
cataccattatccgcctggccactagctgggctacgacaaaaaaagacacagacagcctc
atcgcctgcctgcagccgcatgacttgtaa

DBGET integrated database retrieval system