KEGG   Methylobacterium currus: DA075_04560Help
Entry
DA075_04560       CDS       T05184                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
mee  Methylobacterium currus
Pathway
mee00020  Citrate cycle (TCA cycle)
mee00620  Pyruvate metabolism
mee00650  Butanoate metabolism
mee01100  Metabolic pathways
mee01110  Biosynthesis of secondary metabolites
mee01120  Microbial metabolism in diverse environments
mee01130  Biosynthesis of antibiotics
mee01200  Carbon metabolism
Module
mee_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mee_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DA075_04560
   00620 Pyruvate metabolism
    DA075_04560
   00650 Butanoate metabolism
    DA075_04560
Enzymes [BR:mee01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     DA075_04560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AWB20296
UniProt: A0A2R4WFI6
Position
1:complement(999333..1000859)
Genome map
AA seq 508 aa AA seqDB search
MGQNTRIRHAVLRTKVTSAEHAASLIAPGSTIGMSGFTGSGYPKAVPIALAARMRAAHQS
GTPFQVSIWTGASTGPELDGALAAADGISLRLPYNSDPVARDRINRGEMDYADLHLSQVA
PMAWQGFLGPLDTAVVEVSGIRSDGALVPSSSVGNNKTWLDRARQVILEVNRWQSPALDG
MHDIYYGTALPPHRVPIPILRPEDRVGEPALRCDPDKIVAIVETDAPDRNLPFAAPDAVA
QGIAGHLMDFLSHEVARGRLPASLLPIQSGVGNVANAVLSGLLHGPFEGLTAYTEVIQDG
MLDLLEAGKLRVASATAFSLSTGAASRLNADMARFRDRMILRPQEISNHPEVVRRLGCIA
MNGLIEADIYGNVNSTLVMGSRMQNGIGGSGDFARNAFVSIFMTPSTAKDGTISAIVPQV
SHVDHIAQDVHVLVTEQGLADLRGLSPRRRSELIIARCAHPDYRPLLMEYAERARHRSLG
LHAPMIPGEGLSWHQRFLDHGSMLPSSD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaacacccgtatccggcatgccgtcctccggacgaaggtgaccagcgccgag
catgcggccagcctgatcgccccaggcagcaccatcggaatgagcgggttcacgggctcg
gggtaccccaaggccgtcccgatcgccctggcagcccggatgcgcgctgcccatcagagc
ggcacgccgttccaggtcagcatctggacgggcgcctcgactggcccggaactggacggc
gcgctcgcggctgccgacggcatctccctgcgcctgccctataactcggatccggtcgcg
cgagacaggatcaaccgcggcgaaatggattacgcggatctccacctcagccaggtggcg
ccgatggcctggcagggcttcctcgggccgctggacacggcggtcgtcgaggtctcgggg
atccggtctgacggcgccctggtgccgtcctcgtcggtcggcaacaacaagacgtggctg
gaccgggcacgccaggtcatcctggaggtcaatcgctggcagagcccggcgctggacggc
atgcacgacatctactacggcacggccctgccacctcaccgcgtgccgatcccgatcctg
cggccggaggatcgcgtcggcgagccggccctccgctgcgatcccgacaagatcgtcgcc
atcgtcgagaccgacgcgcccgaccgcaacctgcccttcgccgcgcccgacgcggttgcc
cagggcatcgccggccatctcatggactttctcagccacgaagtggcgcgggggcggctg
ccggcttcgctgctgccgatccagtccggagtcggcaacgtcgcgaacgcggtgctctcc
ggcctgcttcacgggccgttcgagggcctgacggcctacacggaggtgatccaggacggc
atgctggatctcctggaggccggcaagctgcgcgtcgcgtccgcgaccgccttctccctc
agcaccggggccgcctcgcggctcaatgccgacatggcgcggttccgcgaccggatgatc
ctgcgaccgcaggagatcagcaaccatcccgaagtggttcggcgcctcggctgcatcgcc
atgaacggcctcatcgaggccgacatctacggcaatgtgaattccaccctcgtgatggga
tcgcgcatgcagaacggtatcggcggctccggcgatttcgcccgcaacgccttcgtgtcg
atcttcatgacgccatcgacggccaaggacggcacgatctcggccatcgtgccgcaggtc
tcgcatgtcgaccacatcgcccaggacgtccatgtgctggtgacggagcagggcttggcg
gatctgcgcgggctctcgccacggcggcggtcggagttgatcatcgcccgctgcgcccat
cccgattatcggccgctgctcatggagtacgcggagcgcgcccggcaccgctccttgggc
ctgcatgcgcccatgatcccgggcgagggcctgtcctggcatcagcgcttcctcgatcac
ggctcgatgctgccgtcgagcgactga

DBGET integrated database retrieval system