KEGG   Methylobacterium currus: DA075_06760Help
Entry
DA075_06760       CDS       T05184                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mee  Methylobacterium currus
Pathway
mee00790  Folate biosynthesis
mee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DA075_06760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mee04147]
    DA075_06760
Enzymes [BR:mee01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     DA075_06760
Exosome [BR:mee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DA075_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AWB20660
UniProt: A0A2R4WGK4
Position
1:complement(1470075..1470443)
Genome map
AA seq 122 aa AA seqDB search
MPKDDVLSPDVIAARLADLPAWRHADGWITRTYRTNSWKGTLMVINTVGHLAEAAWHHPD
LTASYAWVEVRLTTHSAKGLTEKDFALARKIEEVVGWQPGLEGGALEGTPTDPRFAYIKH
DR
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggacgacgtgctcagccccgacgtgatcgccgcgcgcctcgccgacctgccg
gcctggcggcacgccgacggctggatcacccgcacctaccggacgaacagctggaagggc
accctgatggtgatcaacaccgtcgggcacctcgccgaggcggcctggcaccatcccgac
ctcaccgcctcctatgcctgggtcgaggtgcggctgaccacccattcggccaagggcttg
accgagaaggacttcgccctggcccgcaagatcgaggaggtggtcggctggcagccgggg
ctggagggcggcgcgctcgagggcacgcccacggatccgcgcttcgcctacatcaagcat
gatcggtag

DBGET integrated database retrieval system