KEGG   Methylobacterium currus: DA075_26890Help
Entry
DA075_26890       CDS       T05184                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mee  Methylobacterium currus
Pathway
mee00030  Pentose phosphate pathway
mee00480  Glutathione metabolism
mee01100  Metabolic pathways
mee01110  Biosynthesis of secondary metabolites
mee01120  Microbial metabolism in diverse environments
mee01130  Biosynthesis of antibiotics
mee01200  Carbon metabolism
Module
mee_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DA075_26890
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DA075_26890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mee04147]
    DA075_26890
Enzymes [BR:mee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     DA075_26890
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     DA075_26890
Exosome [BR:mee04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DA075_26890
  Exosomal proteins of colorectal cancer cells
   DA075_26890
  Exosomal proteins of bladder cancer cells
   DA075_26890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AWB24059
UniProt: A0A2R4WR96
Position
1:complement(5854476..5855996)
Genome map
AA seq 506 aa AA seqDB search
MTSHVPVEGHAASGSRPAPPCTIVIFGAGGDLTKRLLMPALYNLAGSHLLDGTTTIWGVD
HSDATDETWRQNLSDTMESFTKDETAEFHAKHIDPTAWGFVRDRLHYLKGDFLAPETYRQ
IGDRIPGNAVFYLAVAARFFAPIVEHLGQAGLLKQSDDGFRRVVIEKPFGSDLASAQALN
RRILAVADESQLYRIDHFLGKETVQSIMAIRFANGMFEPIWRRDFVDHVQVTAAETIGVE
ERGAFYEPTGALRDMVPNHLFQLLCMTAMEPPVSFDAEAVRTEKAKLVQAVRPVQPEDAV
RGQYRAGTVQGRAVPAYRDEPHVAEDSRTETYAALKLTIDNWRWGGVPFYLRTGKRMTGR
RTEIAVHFKPAPYRLFRDTPVDEVAPNILRIMVDPVQGMTTEFNAKVPGPSMRLGAVRST
FREGDFFAQEPNVGYETLIYDCLCGDATLFQRADNIEASWAVVDPLVKAWGAGGEPESYE
SGSAGPEAADDLLARDGRRWLPLDRD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctcacgtcccggtggaggggcatgccgcctccggcagcaggccggccccgccc
tgcaccatcgtgatcttcggcgccggcggcgacctgaccaagcgcctcctgatgccggcg
ctctacaacctcgcgggcagccacctcctcgacggcacgacgacgatctggggcgtcgac
cacagcgacgccaccgacgagacctggcgacaaaacctctccgatacgatggagtccttc
accaaggacgagacggcggagttccacgccaagcacatcgacccgacggcgtggggcttc
gtgcgcgaccggctgcactacctcaagggcgacttcctggcgcccgagacctaccggcag
atcggggacaggattcccggcaacgcggtgttctacctcgcggtggcggcacgcttcttc
gcgccgatcgtcgagcatctgggccaggccgggctgctgaagcaatccgacgacggattt
cgccgggtcgtgatcgagaagcccttcggcagcgacctcgcctcggcgcaggcgctgaac
cggcggatcctcgcagtcgccgacgaatcgcagctctaccggatcgaccatttcctagga
aaggagacggtgcagagcatcatggcgatccgcttcgccaacgggatgttcgagccgatc
tggcgccgggacttcgtcgaccatgtccaggtcaccgccgccgagaccatcggcgtcgag
gagcgcggcgccttctacgagccgaccggggcgctgcgcgacatggtgcccaaccacctg
ttccagctcctgtgcatgaccgcgatggagccgccggtctccttcgacgccgaggcggtg
cggaccgagaaggcgaagctcgtccaggccgtgcgcccggtccagccggaggacgcggtg
cgcggccagtaccgggccggcaccgtgcaggggcgtgccgtgccggcctaccgcgacgag
ccgcacgtggccgaggacagccgcaccgagacctacgcggccctgaagctcaccatcgac
aactggcgctggggcggggtgccgttctatctccgcaccggcaagcggatgaccgggcgg
cgcaccgagatcgcggtccacttcaagcccgcgccctaccggctctttcgcgacaccccg
gtcgacgaggtcgcccccaacatcctgcggatcatggtcgatccggtccagggcatgacc
accgagttcaacgccaaggtgccgggcccgtcgatgcggctcggcgccgtgcgctcgacc
ttccgcgagggggatttcttcgcgcaggagccgaatgtcggctacgagaccctgatctac
gattgcctgtgcggcgatgccaccctgttccagcgcgccgacaacatcgaggcctcctgg
gccgtggtggatccgctggtgaaggcctggggagcgggcggcgagccggaatcctacgaa
tccggcagtgccgggccggaggcggccgacgacttgctcgcccgcgacggccggcgctgg
ctcccgctcgatcgcgattag

DBGET integrated database retrieval system