KEGG   Methylobacterium currus: DA075_31215Help
Entry
DA075_31215       CDS       T05184                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mee  Methylobacterium currus
Pathway
mee00630  Glyoxylate and dicarboxylate metabolism
mee00710  Carbon fixation in photosynthetic organisms
mee01100  Metabolic pathways
mee01110  Biosynthesis of secondary metabolites
mee01120  Microbial metabolism in diverse environments
mee01130  Biosynthesis of antibiotics
mee01200  Carbon metabolism
Module
mee_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mee_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mee_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DA075_31215
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DA075_31215
Enzymes [BR:mee01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DA075_31215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF2721
Motif
Other DBs
NCBI-ProteinID: AWB25371
UniProt: A0A2R4WV11
Position
2:complement(248322..249596)
Genome map
AA seq 424 aa AA seqDB search
MSQRPAAPPIRIEADYLLETASDPGRVAETMAGEQSSGTFVPVPGETPELKARSAARVER
LEVLDEAVAGPSLPTTAAVDPARLRRAHVTLSWPIENLGPSLPNLLATVAGNLFELRPIT
GLRLLDIRLPQAFAEAYPGPRFGIGGTRRLAGIEGRPIIGTIIKPSVGFGPEETAALVRT
LCEGGIDFIKDDELQADGPHCPFDDRARAVMRVVNDHAERTGRKVMVAFNLTGEIDQMRR
RHDLVRDLGGTCVMASLNSVGLVGMIELARMSELPIHAHRNGWGYLARHPLLGWSYVAWQ
KIWRLAGADHMHVNGLDNKFSEDDDSVVASARTCLTPLFPDKPCLAMPVFSSGQTVRQAP
GTFAALGSTDLIVTAGGGIVAHPGGPGEGVAALRQAWEAAVAGIPLPDHARTHPALAQAL
EGAA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtcctgccgcgcccccgatccggatcgaggccgactacctgctcgagacc
gcgagcgatcccggccgggtggcggagacgatggccggcgagcaatcgagcggcaccttc
gtgcccgtgccgggggagacaccggagctcaaggcccgctccgccgcccgggtcgagcgc
ctggaggtgctggacgaggccgttgccggcccgtcgctgccgaccaccgccgcggtcgat
ccggcccgcttgcgccgcgcgcacgtcaccctgtcctggccgatcgagaatctcggtccc
tcgctgccgaacctcctggccaccgtcgccggcaacctgttcgaattgcgcccgatcacg
ggcctgcgcctcctcgacatccggctgccgcaggccttcgccgaggcctatccgggcccg
cgattcggaatcgggggcacgcggcgcctcgccggcatcgaggggcgcccgatcatcggc
accatcatcaagccgagcgtcggcttcgggcccgaggagaccgccgccctggtgcgcacc
ctctgcgagggcggcatcgacttcatcaaggacgacgaattgcaggccgacgggccgcat
tgcccgttcgacgaccgggcgcgcgcggtgatgcgggtcgtcaacgaccatgccgagcgc
accggccggaaggtgatggtcgccttcaacctcaccggcgagatcgaccagatgcgacgg
cgccacgacctcgtgcgcgacctcggcggcacctgcgtgatggcgagcctcaactcggtc
ggcctcgtcgggatgatcgagctggcgcggatgagcgaattgccgatccacgcccatcgc
aacggctggggctatctcgcccgccacccgctgctcggctggtcctacgtcgcctggcag
aagatctggcggctcgccggcgccgaccacatgcatgtcaacggcctcgacaacaagttc
tcggaggacgacgacagcgtcgtcgcctcggcccgcacctgcctgaccccgctctttccc
gacaagccctgcctcgccatgccggtcttctcatcgggacagacggtacggcaggcgccc
ggcaccttcgcggccctcggctcgaccgatctcatcgtgacggcgggcggcggcatcgtc
gcccatccgggcgggcccggcgagggggtggcggccctgcgccaggcctgggaggcggcg
gtcgcgggcatcccgctccccgaccatgcccgcacccatccggctctggcccaggcgctg
gagggagcggcgtga

DBGET integrated database retrieval system