KEGG   Methanosarcina sp. WH1: MSWH1_0533Help
Entry
MSWH1_0533        CDS       T03851                                 

Definition
(GenBank) Sodium/potassium-transporting ATPase, alpha subunit
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mef  Methanosarcina sp. WH1
Brite
KEGG Orthology (KO) [BR:mef00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mef04147]
    MSWH1_0533
Enzymes [BR:mef01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     MSWH1_0533
Exosome [BR:mef04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MSWH1_0533
  Exosomal proteins of other body fluids (saliva and urine)
   MSWH1_0533
  Exosomal proteins of colorectal cancer cells
   MSWH1_0533
  Exosomal proteins of bladder cancer cells
   MSWH1_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-ProteinID: AKB20804
UniProt: A0A0E3NNY9
Position
627158..630007
Genome map
AA seq 949 aa AA seqDB search
MEKDSAENRNKLCFPQGDEHLISLPEFLQRLEVTENGLSEQEATQRLQKCGPNVLEAAGK
ESILKRYVRQFRNFFSILLTVGAILSFLGEYLDPGQGNLYIGIALVGVVVLNGTFTFVQE
YQAAKTMESFRQLLPPHAKVFRDGKVKDVLASELVVGDLILLEEGDKVPADGRLIETNSL
KVDNSSLTGEAEPQLRSIECTHENILECRNMVFSGTLVQSGNGKAIIFGTGQDTQIGSLA
VLTEQTISVDTPIRKELNHFIKVISAIAIFLGITFFLLAFFLQDIFLASLIFAIGIIVAN
VPEGLLPTVTLALSLASRRMASRNALIKQLESVETLGSTTVICTDKTGTLTQNRMAVNSL
IAGFETLEPEKPSIPQEGVAGQNTEESTKKSLAQNGTDSGAKEVSVTGNPGWDPKKIPPV
FIRAAGLCNNAKLYESAPGYTGDPTEGALLVFANGFVDVKDLQREYPRQEEFPFDSLTRR
MEVVCRTPEGKLEVYLKGAPEVVVQMCGSVLESGEARKLDEAGQKELLDRHLRLAEKGER
VIALAFRQAEEEKEYTGDFIFLGFIGIVDPPRPEAREAIAKCHAAGIKVVMITGDHPVTA
ESIARDVGLAGSEKPEIITGDELKSLSRTELASRLKNPSIVFARTSPVQKLKIVQLFQAE
GEIVTMTGDGVNDAPAIKNADMGVAMGSGTDVAREAADMVLLDDNFATIVNAVEEGRTVF
DNIKKFIAYILTSNIPEILPFIAFVLFSIPLPMTVQLILAIDLGTDILPAIALGVEKGEG
DIMKRSPRPRDEKLLTSQVLLTSYGVKGPIEAAAGFFCYFAVLFEGGWIFGEQLANTNPL
YMQAITAFFSAVIICQIANVFASRTRFQSVFSMGLFSNRPVLLGIASEFLILALIIWHPF
ANLIFNTTPIDLRYMLLAVPFAVFLLGIDELRKYLLRKNVNWAVRFFKW
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggactcggctgaaaacagaaacaaactatgcttcccacagggggatgaacat
ctaatttctcttccagagtttctacagaggctagaagtcacagaaaacgggctcagtgag
caggaagctacccagaggctccagaaatgcggaccaaatgtcctcgaagcagccggaaag
gaaagcatacttaagagatatgtccggcagtttcgtaactttttttctatcctgttgact
gtaggggctattctatcttttcttggcgaataccttgatcccgggcagggaaacttatat
ataggaattgctctcgtcggggtcgttgtccttaacggaactttcacgtttgtgcaggag
taccaggctgcaaagacaatggaaagcttccggcagcttctgccacctcatgcaaaagtc
ttcagggacggaaaggtaaaggatgttctggcttcagagcttgttgtgggggatctcatc
cttcttgaagaaggagataaggttcctgcagacgggcgtttgattgagaccaattctctg
aaagtcgataattcctccctgaccggagaagcggagccgcagctgcgctctatcgagtgt
acacatgagaatatactggaatgccggaatatggtcttttccggaactcttgtacagagc
gggaacggtaaagccattattttcggtaccgggcaggatacccagatcggaagcctggca
gtgcttacggagcagaccatctctgtggacactcctatccgaaaagaactcaaccatttc
ataaaggttatttcagcaattgcgatttttcttggaattacctttttcctgcttgcattt
tttctccaggatatctttcttgcaagccttatctttgccataggaatcattgttgccaat
gttcctgaagggcttttgcccaccgttacgcttgccctcagccttgcttctcggagaatg
gcttctcgaaatgcccttataaagcagcttgagtctgtagaaaccctgggctcgactacc
gtgatttgtacggataaaaccgggaccctgactcagaacaggatggcagtaaattcgctt
atcgcagggtttgaaactctggagccggaaaaaccttccattcctcaagaaggcgttgca
gggcagaatacagaagaaagtacaaaaaaaagtcttgcgcagaacggtactgactcaggc
gcaaaagaagtttctgttacaggaaatcccggatgggatccgaaaaagatccctccggtt
ttcataagggcggcagggctctgcaataacgcaaaactttatgaatcggcccctggatat
accggcgacccgacagaaggtgcgcttcttgtttttgcgaatggtttcgtagatgtaaaa
gacctccagcgagagtatccgagacaggaagagtttcctttcgattcccttacccgacgc
atggaagttgtctgccgaactcccgaaggaaaacttgaggtatacctcaagggcgctccg
gaagtggttgtgcagatgtgcgggtcggttctggagtccggagaggccagaaaactggat
gaagccgggcaaaaagagcttctagataggcatctaaggctggcagaaaagggagaaagg
gtaattgcccttgcgttcaggcaggcagaagaggagaaagagtacaccggagattttatt
ttcctgggtttcatcgggattgtagaccctccacgccctgaagcgagagaagctattgca
aaatgtcatgcagcaggaatcaaggttgttatgatcacaggtgatcacccggttaccgca
gagtccattgccagagatgtaggacttgcaggttccgaaaaacctgagattattaccgga
gatgagcttaaatccctctcccgcacagagcttgcttcacggctcaaaaacccgagcatt
gtttttgcccgaacctctcctgtacagaaattaaaaattgtacagctcttccaggcagaa
ggagagatcgttaccatgaccggagatggggttaatgatgcccccgcgatcaagaatgcc
gatatgggggtcgctatgggcagcggcacggatgtggctcgtgaggctgcagacatggtg
cttctggacgacaattttgccacgatagtaaatgctgtggaagaaggcagaaccgtcttt
gataatataaaaaagtttattgcttacatcctcacaagcaacatccccgagatcctccca
tttatagcttttgttcttttttccattccccttcccatgactgtccaacttatcctggca
attgatctcggaactgatatccttcctgccattgctctgggggtggaaaaaggagaggga
gatattatgaagagatctcccagaccaagggatgaaaagttattaacctctcaggtgctt
ttgacatcttacggagtaaaaggacctatagaggctgctgcaggcttcttctgttatttt
gccgtactttttgaagggggctggattttcggggagcagcttgcaaacactaatcccctt
tatatgcaggcaataaccgctttcttctcagctgtgattatctgccagatcgctaatgtg
tttgcttcaagaactcggtttcagtctgtcttctcaatgggattgttcagcaaccgcccg
gttctcctgggaattgcaagcgaatttctgattcttgctctcattatctggcatccattt
gctaaccttattttcaataccactcccattgacctcaggtatatgctacttgccgttcct
tttgcggttttcctccttgggatcgatgaactgaggaaatatctcctgagaaaaaacgtg
aactgggcagttagattctttaaatggtga

DBGET integrated database retrieval system