KEGG   Megasphaera sp. AJH120: DKB62_02590Help
Entry
DKB62_02590       CDS       T05599                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
meg  Megasphaera sp. AJH120
Pathway
meg00670  One carbon pool by folate
meg01100  Metabolic pathways
meg01120  Microbial metabolism in diverse environments
meg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:meg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DKB62_02590
Enzymes [BR:meg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     DKB62_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AXL20545
UniProt: A0A346AXF2
Position
complement(525785..527464)
Genome map
AA seq 559 aa AA seqDB search
MAQVLSDIEIAQQTALEPIVKIAEKVGLTDDDLELYGKYKAKISFDAIKRLSKNEDGKLV
LVTAITPTPAGEGKTLTTIGLAQALNYMGHKAVVALREPSLGPVFGIKGGAAGGGYSQVL
PMEDINLHFTGDMHAITAANNLLAAAIDNHVHQGNALRIDVRRVIWKRVMDMNDRALRNI
VVGMGGKVCGFPREDHFMITVASEIMAALCLASDLMDLKKRMGDITVAYDLDGNLVTARQ
LGVEGAMAILMKDAIKPNLVQTIEHTPALVHGGPFANIAHGCNSVVATKLALKMGDIAVT
EAGFGADLGAEKFMDIKCRFAGIKPNAVVVVATARALKMHGGVDKKNLQEENIEALKKGF
ANLAKHVENMRTYDVPVVVGINKFATDTDAEIATLRQLCADYGVDAALNNCWAEGGKGGV
ELGEKVLQLIAQPQTPYKPLYDVNDTIAQKMETIVKKIYGGAGVVFESKAQKQVAELEKF
GLDKMPLCVAKTQYSLSDDPSLLGAPKDFTVTVKDVRVCTGAGFIVCQTGDIMTMPGLPK
VPAANRMDIDENGVITGLF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtattaagcgatattgaaattgcacagcagaccgcgctggaaccgatcgta
aagattgcggaaaaagtcggattaactgacgatgatttggaattatacggtaaatataag
gcaaagatttcctttgacgctatcaagcgcctttcgaaaaacgaagacggcaagcttgtc
ctcgtcacggctattacgccgacgccggccggcgaaggcaagacgctgacgacgatcggc
ctcgcccaggcgctgaactacatggggcataaggccgtcgtcgcccttcgcgaaccttcc
cttggccccgtattcggcattaagggcggcgctgccggcggcggctactcgcaggtactg
ccgatggaagatattaatctccattttacaggcgacatgcacgctattacggcggccaac
aatcttctggccgctgccatcgacaaccacgttcatcagggcaacgccctgcgcatcgac
gtgcgccgcgtcatctggaagcgcgtcatggacatgaacgaccgggccctgcgcaacatc
gtcgtcggcatgggcggcaaggtctgcggattcccgcgggaagaccacttcatgattacc
gttgcctcggaaatcatggcggccctgtgcctggccagcgacctcatggacttgaagaag
cgcatgggtgacatcaccgtagcttatgacttggacggcaacctcgtgacggcccgccag
ctcggcgtcgaaggcgcaatggctatcctcatgaaggacgccatcaagccgaacctcgtc
cagacgatcgagcacacgccggccctcgtacacggcggccccttcgccaacatcgctcat
ggctgcaactccgtcgtagctacgaagctggccctcaagatgggcgatatcgccgttacg
gaagctggtttcggcgcagacctcggcgcggaaaaattcatggacattaagtgccggttc
gccggcattaaaccgaatgctgtcgtcgtcgtcgcaacagcccgggctcttaaaatgcac
ggcggcgtagacaagaagaacttgcaggaagaaaatatcgaagccttgaagaagggcttt
gccaatttggctaagcacgtggaaaatatgcgtacctacgacgttcccgtcgtcgtcggc
atcaataaatttgctaccgatacggatgcggaaatcgcgacgctccgccagctctgcgcc
gattacggcgtcgacgcagccctcaataactgctgggccgaaggcggcaagggcggcgta
gaattgggagaaaaggtactgcagctcatcgcccagccgcagacgccgtacaagccgctg
tacgacgtaaacgacaccatcgcccagaagatggaaacgatcgtcaaaaagatttacggc
ggcgcaggcgtcgtctttgaaagcaaagcgcagaaacaggtggccgagctggaaaaattc
ggcctcgacaagatgcctctctgcgtagcgaagacgcagtattccttgtccgacgatccg
tctctcctcggcgcgccgaaggacttcaccgttaccgtcaaggacgtgcgcgtctgcacc
ggtgcaggctttatcgtctgccagaccggcgacattatgacgatgccgggcttgccgaag
gttcctgctgctaatagaatggatatcgatgaaaatggcgttatcacaggattgttctaa

DBGET integrated database retrieval system