KEGG   Megasphaera sp. AJH120: DKB62_05200Help
Entry
DKB62_05200       CDS       T05599                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
meg  Megasphaera sp. AJH120
Pathway
meg00360  Phenylalanine metabolism
meg00362  Benzoate degradation
meg01100  Metabolic pathways
meg01120  Microbial metabolism in diverse environments
meg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:meg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DKB62_05200
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DKB62_05200
   00622 Xylene degradation
    DKB62_05200
   00621 Dioxin degradation
    DKB62_05200
Enzymes [BR:meg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     DKB62_05200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AXL21009
UniProt: A0A346AYR6
Position
complement(1102729..1103721)
Genome map
AA seq 330 aa AA seqDB search
MHIMDCTLRDGANVVGTGFSTELTKLMIEGLLDSHIHIIEMGHCTGLGSVKAGGKACPVT
DEEYLDVIEPYADKGEIGMFQTAAYADSELIALAASKGLKFLRVGANAGDGKTAEKAVKM
VRDAGLEAKYSLMKAYVVTPDELAEEAKMLESFGVQALTIMDSAGYMMPEDAAEYTRKVV
DAVSIPVGFHGHSNLGLAMANAQAAERAGASFIDCGLMGMARSAGNITTEGAVALFRREG
KAQEYDFYKLLRFIDEKLMPAMEREGYHNPIKPLDLVLGYSGCHSSFVGAFRGVAAAAGV
NVYELIIETSKINQKNPSKDLMEEVAVTLK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcatattatggactgcacgttacgcgacggagccaacgtcgtcggcacaggattttca
acagaattgacgaaattgatgatagaaggcttgctcgacagtcatatccatatcattgag
atggggcactgcaccggcctcggttcggtcaaagccggcggcaaggcttgtcctgtgacg
gacgaagaatatctggatgtcatagaaccttatgctgataaaggggaaatcggtatgttc
cagactgcggcgtatgccgattcagaactaatcgctttagcagcttctaagggattgaaa
tttctccgcgtcggagctaacgccggcgacggaaagacggcggaaaaggccgtgaagatg
gtgcgcgacgccggcctcgaggcaaaatacagcttgatgaaggcgtacgtcgtcactcct
gacgaattggccgaagaagcgaagatgctcgaatccttcggcgtgcaggctcttacgatt
atggactcggccggttatatgatgcccgaagacgcggccgagtatacccgcaaggtagtc
gacgccgtatctattcccgtaggctttcatggacacagtaatttaggactggctatggcg
aatgcccaggctgccgaacgggccggcgcatccttcatcgactgcgggctcatgggtatg
gcccgcagcgccggaaacattacgacggaaggagctgtcgccttgttccgccgcgaagga
aaggcgcaggaatacgatttttacaagctgctgcgcttcatcgacgaaaagctcatgccg
gcgatggaacgggaaggctaccacaatccgattaagcccctcgacctcgtattgggctat
tcgggctgtcattccagcttcgtaggcgcttttaggggagtcgccgcggctgccggtgtc
aacgtatacgaattgattatcgaaacgtcgaagataaatcagaaaaatccgtcgaaagac
ttgatggaagaggtagctgttacattaaagtga

DBGET integrated database retrieval system