KEGG   Megasphaera sp. AJH120: DKB62_07285Help
Entry
DKB62_07285       CDS       T05599                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
meg  Megasphaera sp. AJH120
Pathway
meg00450  Selenocompound metabolism
meg00970  Aminoacyl-tRNA biosynthesis
meg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DKB62_07285
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DKB62_07285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:meg01007]
    DKB62_07285
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:meg03016]
    DKB62_07285
Enzymes [BR:meg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DKB62_07285
Amino acid related enzymes [BR:meg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DKB62_07285
Transfer RNA biogenesis [BR:meg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DKB62_07285
 Prokaryotic type
   Other AARSs
    DKB62_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AXL21378
UniProt: A0A346AZT5
Position
1557212..1559149
Genome map
AA seq 645 aa AA seqDB search
MAEKKTYYITTPIYYPSAKLHIGHTYCTTIADSLARFHRLRGDDVFFLTGSDEHGQKIQR
AAEAKGVKPIEYVDEIVALFQQLWKKLNISNDDFIRTTEERHEKVVQKLMQISYDNGDIY
KGEYAGWYCTPCESFWPENKLPEGQHICPDCGRPLELVKEEAYFLKMNKYADRWLKFIEE
NPDFIQPESRRNEMIAFVKSGLEDLCVSRTSFDWGIKVPWDPKHVVYVWFDALANYLTAA
GYIDDPEKFEKFWPANLHLVGKEIVRFHTIIWPIMLMSCGLPLPKKVFGHGWLIVDGTKM
SKSLGNVVDPIPLIERYGADALRYYLLKEVRLGQDGNFSLPSFINRINSDLANDLGNLLQ
RTLAMVEKYEGGVAAGPTVKEPVDDELAACAVETAKQFEALMDDMKINDAINDVWGLIRR
SNKYIDETTPWVLAKDEAKAERLQTVLYNLLESLRVIALLVSPFIPVSAADMWKQLGLAD
FDKALLSDGQTWGGYPAGTKVCKGNALFPRYDLKEEIAEDEAAKKAAQACPAAQEPTKPE
ISIDDFGAVDLRVGKVVACDKIPKAKKLLKLQIDLGTETRQVVSGISQYYEPQDLVGKSV
VVVTNLKPVKLCGVESKGMILAASDGNGNLQVVFADGMAPGSRVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagaagacctattacattacgactcccatctactaccccagcgccaagctg
cacatcgggcatacgtactgcacgaccatcgccgactcgctggcccgtttccaccgcctc
cgcggcgacgacgtctttttcctgaccggctcggacgaacacggccagaaaatccagcgt
gccgccgaagccaaaggcgtcaaacctatcgaatacgtcgacgaaatcgtcgccctcttc
cagcagctctggaaaaagctcaacatttccaacgacgacttcatccgcacgacggaagaa
cggcacgaaaaggtcgtacagaagctcatgcagatttcctacgacaacggcgacatctac
aagggcgaatacgccggctggtactgcacgccctgcgaatccttctggccggaaaacaag
ctgcctgaaggacagcacatctgcccggactgcggccgtccccttgagctggtcaaggaa
gaagcctacttcctgaaaatgaataaatacgccgaccgctggctgaaattcatcgaagaa
aatcccgatttcatccagcccgaatcgcggcgcaacgaaatgatcgccttcgtcaagagc
ggcctcgaagacctgtgcgtatcccgcacgtccttcgactggggcatcaaggtaccctgg
gacccgaagcacgtcgtatacgtctggttcgacgccctggcaaactacctgacggcggcg
ggttacatcgacgacccggaaaaatttgaaaaattctggccggccaacctgcacctcgtc
ggcaaggaaatcgtccgcttccatacgatcatctggccgatcatgctcatgagctgcggc
ctgcccctgccgaagaaggtctttggccacggctggctcatcgtcgacggcacgaagatg
agcaaatctttgggcaacgtcgtcgaccccattcccctcatcgaacggtacggggccgac
gccctgcgctactacctgctcaaggaagtgcgcctcggccaggacggcaacttctccctg
ccgtcgttcatcaaccgcatcaattccgatctggccaacgacctgggcaacctcctgcag
cgcaccctggccatggttgaaaaatacgaaggcggcgtcgccgccggcccgacggtcaaa
gaacctgtcgacgacgaactggcagcctgcgccgtcgaaacggccaagcagtttgaagcc
ctcatggacgacatgaagatcaacgacgccatcaacgacgtctggggcctcatccgccgc
agcaataaatacatcgacgaaacgacgccgtgggtcctggccaaagacgaagccaaggcc
gaacgcctccagaccgtcttgtacaacctcctcgaatcgctgcgggtcatcgccctcctc
gtcagccccttcatccctgtcagcgccgccgacatgtggaaacagctcggcctggctgac
ttcgacaaggccctcctttccgacggccagacctggggcggctatccggccggtacgaag
gtctgcaagggcaatgccctcttcccgcggtacgacttgaaggaagaaatcgctgaagac
gaagcggctaagaaggcggcccaggcctgcccggcagcgcaggaaccgacgaagccggaa
atctccatcgacgatttcggcgccgtagatctgcgcgtcggcaaggtcgtcgcctgcgat
aagattcccaaggcgaaaaaactcctgaagctgcagatcgacctcggcacggaaacgcgc
caagtcgtcagcggcatttcccagtactacgaaccgcaggacctcgtcggcaagagcgtc
gtcgtcgtgacgaacttgaagcccgtgaagctgtgcggcgtcgaatcgaagggcatgatt
ttggcagcctccgacggcaatggcaacctgcaggtcgtcttcgccgacggcatggcgccg
ggaagccgggtgcgctga

DBGET integrated database retrieval system