KEGG   Methylotenera versatilis: M301_0798Help
Entry
M301_0798         CDS       T01247                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
meh  Methylotenera versatilis
Pathway
meh00020  Citrate cycle (TCA cycle)
meh00640  Propanoate metabolism
meh00660  C5-Branched dibasic acid metabolism
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01120  Microbial metabolism in diverse environments
meh01130  Biosynthesis of antibiotics
meh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M301_0798
   00640 Propanoate metabolism
    M301_0798
   00660 C5-Branched dibasic acid metabolism
    M301_0798
Enzymes [BR:meh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     M301_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADI29182
UniProt: D7DPD8
Position
912454..913617
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKTLLQKYGIPVPRGQVVTVAKDTAAATTEIASDAWVVKAQIHAGGRGKAGGV
KLVKSTTEAQAVVSELLGKTLVTYQNAPDGQLVNQVLIEETLPIARELYLSMLVDRTLER
VVIIASSAGGMDIEEIAQTSPEKILEEVCDPLNGVVDFQARNLAFKLDLVGEQISAFTKI
LKGLYRLFKENDLALLEINPLVVTAEGKLFALDCKMSIDDNALYRQKALAEQRDWSQEDS
KEAVAHHAGLNYIALNGNIGCMVNGAGLAMATMDLIKLHGGTPANFLDVGGGATAETVTK
AFKIILADNNVKAILVNIFGGIMRCDIIAEGIITAVKDVGMQIPVIVRLEGTNVDLGKQM
LQTSGLNIISANGLTDAAVQAVKAVSA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcacgaatatcaggccaaaactttactgcaaaagtacggcattccagttcca
cgtgggcaagtggtgacagtggctaaagacacggctgctgcgactacagaaatcgccagt
gatgcatgggttgtgaaggcgcagatccatgctggtggtcgcggtaaagcgggtggtgtt
aagttggttaaatcaaccacagaagcgcaagcggttgtgagcgagcttttaggcaaaacc
ttagtgacctatcaaaatgcgccagatggccaacttgtaaaccaagtgttgattgaggaa
acgctgccaatcgcacgcgagctttatctgtctatgctggtagatagaacgctggagcgt
gtggtgattattgcgtcaagtgctggtggcatggatattgaagaaatcgcgcaaactagc
cctgagaaaatcttagaggaagtgtgcgatccgttaaatggcgttgtggattttcaggcg
cgcaatttggcgtttaagttagatttagttggtgagcaaattagtgcttttactaaaatt
ttaaaaggcctgtatcgtttattcaaagaaaatgatttggctttgctggaaattaatcca
ctagtggtgacggccgagggtaaattatttgccttagattgtaaaatgagtattgatgat
aatgcgctgtatcgtcaaaaagccttggctgagcaacgtgattggtcacaagaggacagt
aaagaagcggttgcgcatcatgctggcttaaattatatcgcgcttaacggcaatatcggc
tgcatggtcaatggagcagggttggccatggcaactatggatttaatcaagctgcacggc
ggaacgccagctaacttccttgatgtgggtggtggcgcaacggctgaaactgtaactaaa
gcattcaaaattatcttagcagacaataatgttaaagccattttagtgaatattttcggt
ggcattatgcgctgtgacatcattgcagaaggtattatcactgcagttaaagatgtcggt
atgcaaattcccgtcatcgtgcgtttagaaggtaccaatgtggatttaggtaaacaaatg
ttgcaaacaagtggattgaatattatttcagcaaatggtctgacagatgctgccgtgcaa
gctgtgaaggcggtgtcagcatga

DBGET integrated database retrieval system