KEGG   Methylotenera versatilis: M301_1047Help
Entry
M301_1047         CDS       T01247                                 

Definition
(GenBank) aminotransferase class-III
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
meh  Methylotenera versatilis
Pathway
meh00860  Porphyrin and chlorophyll metabolism
meh01100  Metabolic pathways
meh01110  Biosynthesis of secondary metabolites
meh01120  Microbial metabolism in diverse environments
Module
meh_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:meh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M301_1047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:meh01007]
    M301_1047
Enzymes [BR:meh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     M301_1047
Amino acid related enzymes [BR:meh01007]
 Aminotransferase (transaminase)
  Class III
   M301_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF2231 DUF3731
Motif
Other DBs
NCBI-ProteinID: ADI29431
UniProt: D7DQ60
Position
complement(1171015..1172385)
Genome map
AA seq 456 aa AA seqDB search
MLNPDLITNAHALLASERANYMKLHPKSAELSVKANQHFLYGVPMHWMNDWGTPVPLFIS
HAEGAHFTCADGIDYTDFCLGDTGAMFGHSSAPVAKAIAAQASRGYTAMLPSTLAPDVGE
TLSDFFGLDYWQLATTATDANRFVLRWARAVTGRSKLLVFDGCYHGTIDDTEIDVVNGKT
VNRASLLGQVYDLGLHTVAVPFNDLAAVEHELAKGDVAVLLTEPALTNCGMVLPHAGFIE
SLRALTTKYGTLLTLDETHTISTARGGWAKANSVTPDFLVVGKPIAGGLPAAAYGFSEAM
AVRMKAAKDNAPAGHSGIGTTLSGNMMTLAAINATLRDTATEAAYLHMLALAAKLETQLN
AAIRAYNLPWNISRMGARLELQFCTNPPSNAAEARAAQNDTIESAIHLYLLNRGVLLTPF
HNMMLICPATTEADIAKLVRIFNEFLKDLLKGLRNE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcccgacttaatcactaacgctcacgccctgctagcaagtgagcgcgccaac
tacatgaagctgcaccctaagtccgccgaattatcagttaaggccaaccaacactttctg
tatggtgtgcctatgcattggatgaacgattggggcacacctgttccgctatttatcagt
catgccgaaggtgcacactttacctgcgcagacggtattgattacacagatttctgttta
ggcgacacgggcgccatgtttgggcatagttctgcgccagtggctaaggcaatcgccgca
caagctagtcgtggctacaccgcgatgttgccgtccacacttgcgcctgatgttggtgag
actttaagcgacttctttggcttagattattggcagcttgccaccacagcgacagatgcg
aatcgctttgtattgcgctgggcacgtgcggtgactggtcgcagcaagctattagtgttt
gatggttgctaccatggaacaatagatgacactgagatagatgttgttaatggcaaaaca
gttaaccgtgccagtttattaggtcaagtgtacgatttaggcttacacacagtggcagtg
ccatttaatgatttagccgccgttgaacatgaattagccaagggcgatgtcgcagtgctg
ctcactgaaccagcgctcaccaactgtggcatggtattaccgcacgcaggttttattgaa
agtttacgcgcactcaccacaaaatatggcacattattaacgcttgatgaaacccacaca
atatcaacagcgcgcggcggctgggctaaagccaatagcgtcacaccggacttcttagta
gttggcaaacccatcgcaggaggtttacctgcagcagcctatggttttagcgaggcaatg
gcagtccgtatgaaagcagccaaagacaacgcacctgctgggcattctggcataggtacg
actttatctggcaatatgatgacactagcggctatcaacgcgacattacgcgacactgct
accgaagcagcatacctacacatgcttgctctggcagccaagctagaaactcaactaaac
gcggcaatcagagcatataacttgccatggaatattagccgcatgggcgcgcggcttgag
ttgcaattttgtacaaatccgcccagcaatgctgcagaagcacgcgcggcacaaaacgac
accatagaatctgccatacatttatatttgcttaatcgcggcgttttactcacaccattt
cacaatatgatgttgatttgccccgcaacaacagaagctgatattgcaaaattagtacga
atatttaatgagtttttaaaggatcttttaaagggattacgcaatgagtaa

DBGET integrated database retrieval system