KEGG   Methylotenera versatilis: M301_1378Help
Entry
M301_1378         CDS       T01247                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
meh  Methylotenera versatilis
Pathway
meh00920  Sulfur metabolism
meh01100  Metabolic pathways
meh01120  Microbial metabolism in diverse environments
meh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    M301_1378
Enzymes [BR:meh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     M301_1378
Transfer RNA biogenesis [BR:meh03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    M301_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: ADI29761
UniProt: D7DI76
Position
complement(1529166..1529972)
Genome map
AA seq 268 aa AA seqDB search
MSYHQYLEQVIVIAKAAGDAIMQVYSTDFNVVKKDDNSPLTQADLAAHQVIVQALSKLTP
DIAILSEESDSIGFETRRQWQQYWLIDPLDGTREFVKRNGEFTVNIAFIDRHQPVLGVVY
APVTGLLYYASHGHGAYKQLETNHTQSIHTRLLNLKQPTVAGSRSHCNEKMQQFMRNLES
VAGVAPELISMGSSLKICLVAEGLADVYPRLGPTSEWDTAAAHCVLMEAGGDIVDMSNHS
LLYNTKDSLLNPSFFAKGDGAHNWSVYL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccatcaatatcttgagcaagtcattgttatcgcgaaagccgccggtgacgcc
atcatgcaggtatattcaacagattttaatgtcgttaaaaaagatgacaactcaccgctt
actcaggctgatttagccgcacaccaagtgattgttcaggctttaagcaagctcacgcca
gatattgctattctttctgaagaatcagacagtataggttttgaaacgcgccgccagtgg
caacaatactggctgatagatcctttggatggcacgcgggagttcgtcaaaagaaatggt
gaatttaccgttaatattgcctttatagatcgccatcagcctgtgcttggcgtcgtgtac
gccccagtgactggcttgttgtattacgccagccacggccatggtgcttataagcagcta
gaaacaaatcacactcaaagtattcatactcgattattaaatctaaaacagccaactgtc
gcaggtagtcgttcgcactgcaatgaaaaaatgcagcaattcatgcgcaatttagaaagc
gtcgcaggtgtagcgcctgaactaattagcatgggcagctctctaaaaatctgtttagtg
gctgaaggtttggcggacgtgtatccaaggttaggacctacctcagaatgggacaccgca
gcggcacattgcgtattgatggaagcgggtggcgatatagtggatatgtctaatcattca
ttgctttataacaccaaagattctttattgaaccctagcttttttgctaaaggtgatggc
gctcacaactggtcagtttatttataa

DBGET integrated database retrieval system