KEGG   Methylotenera versatilis: M301_1474Help
Entry
M301_1474         CDS       T01247                                 

Definition
(GenBank) Stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
meh  Methylotenera versatilis
Pathway
meh01040  Biosynthesis of unsaturated fatty acids
meh01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    M301_1474
Enzymes [BR:meh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     M301_1474
Lipid biosynthesis proteins [BR:meh01004]
 Desaturase
  First
   M301_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF456
Motif
Other DBs
NCBI-ProteinID: ADI29856
UniProt: D7DIH1
Position
1636452..1637396
Genome map
AA seq 314 aa AA seqDB search
MLKKIIKWFDNEAVIIPEDGLSYRANWRQIDLWRVIPFVLLHLACFAVFWVEFSWFALVF
AIALYAIRMFAITGFYHRYFSHKAFRTTRVFQFILAVFGATAVQRGPLWWASHHRHHHIK
SDEIDDAHSPVQHGFLWSHLGWFLSNKHFATQTERVKELAKFAELRLLDRFDIVVPILFG
LSIYLLGVWLESYYPNLNTNGMQLLVWGFAISTVVLYHATFTVNSLAHVWGKRRYATSDQ
SRNNLWIALLTLGEGWHNNHHHYPGSARQGFYWWEIDLTFYGLKLLAACGLIWDVRTVPT
AIRESKKINRTISR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagaagattattaaatggtttgataatgaagccgtgattatccccgaggatggt
ctgagctatcgcgcaaactggcgccaaattgatttgtggcgcgtgattccatttgtgtta
ttacatttagcttgcttcgcagttttttgggtcgaatttagctggtttgcactggttttt
gccattgcactttatgccattagaatgtttgcaatcactggtttttaccatcgttatttt
tcacacaaggcttttcgcaccacacgtgttttccagtttattctagctgtgttcggcgcc
actgcagtgcagcgcggccctttgtggtgggcttcgcatcataggcatcaccatattaaa
tcagatgaaatagacgatgcgcactcccctgtgcaacatggatttttatggagtcacttg
ggctggtttctttcaaacaaacacttcgccacacaaactgagcgcgtcaaagagctggct
aagtttgcagaattacgtttactcgatcgttttgatatcgttgtaccaattctttttggc
ctgagtatttacttattaggcgtatggcttgagagctattacccaaacctgaacaccaat
ggcatgcaattgctggtctgggggtttgctatatctaccgtagtgttatatcacgccaca
ttcacggtgaactcgctcgcacacgtttggggcaagcgtcgctatgcaactagcgatcaa
agccgcaataacctatggattgcattgttaaccttaggcgaaggctggcataacaaccat
catcactaccctggctctgcgcgacaaggtttttattggtgggaaatagacttaacgttt
tatggcttaaagctacttgcagcctgcgggttaatatgggacgtcagaactgttcccaca
gctatccgcgaatcaaaaaaaataaatagaacaatcagtcgttaa

DBGET integrated database retrieval system