KEGG   Methylovorus glucosetrophus: Msip34_1274Help
Entry
Msip34_1274       CDS       T00943                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00010  Glycolysis / Gluconeogenesis
mei00052  Galactose metabolism
mei00500  Starch and sucrose metabolism
mei00520  Amino sugar and nucleotide sugar metabolism
mei00521  Streptomycin biosynthesis
mei01100  Metabolic pathways
mei01110  Biosynthesis of secondary metabolites
mei01120  Microbial metabolism in diverse environments
mei01130  Biosynthesis of antibiotics
mei01200  Carbon metabolism
Module
mei_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msip34_1274
   00052 Galactose metabolism
    Msip34_1274
   00500 Starch and sucrose metabolism
    Msip34_1274
   00520 Amino sugar and nucleotide sugar metabolism
    Msip34_1274
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msip34_1274
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Msip34_1274
Enzymes [BR:mei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Msip34_1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACT50520
UniProt: C6XD95
Position
1378666..1379595
Genome map
AA seq 309 aa AA seqDB search
MFLGVDIGGTNLRVGVVQHHALIHEQRALADFSGLCARHPPDEAWRQIIATTAATLRQCL
MQYPQAKAVGIGFPGFIDPVHGTVAQSPNLPGLRNVDLAGDLSAAIGLPVVVENDALAAA
YGEYVLCDPKPHSLLYAGLGTGVGGGMIYAGRPFTGEHGVAMEIGHLIVEPGGRLCGCGN
HGCMEQYASASGIAQSYHMATGQRVEVNAIAQAAREGGQAAVEAFSLAGAALAQALAHVV
KSVDVGLIVIGGGVSQAWDLMAPAFFTRLEHDMIPVLRDRLRVQPSASGDRAGIIGAAAL
AEIILASSS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaggcgttgatataggcggcaccaatctgcgagtgggcgtggtgcagcaccac
gcattgattcatgagcagcgcgcactggctgacttttctggtctgtgtgcccggcacccc
ccggacgaggcatggcggcagattattgcgactacggcggccaccttgcgccagtgcctc
atgcaatatccccaggcaaaggccgttggtattggtttcccaggctttattgatccggtg
cacggtaccgtagcgcagtcgcccaacctgcctggcttgcgcaatgtggacctggctggc
gatctgtcggccgccattggtctgccggtcgtagtggaaaacgatgctctggctgcggcc
tatggcgaatatgtactttgtgatcccaagccacacagtcttctttatgccgggctcggt
actggtgtgggtggcggcatgatctatgctggccgcccatttaccggcgagcacggggtt
gccatggaaatcggccatttgattgtggagcctggtgggcggttatgtggctgcggcaat
catggctgcatggagcaatatgcgtccgccagtggcatagcgcagagttaccacatggcg
accggtcagcgcgtggaggtcaatgccattgcccaggctgcgcgcgaaggtgggcaggcg
gcggtggaggctttttcccttgccggtgccgcactggcacaagcgctggcgcatgtcgtc
aagagcgtagatgtcgggcttatcgtgattggtggtggcgttagtcaggcttgggacttg
atggcacctgctttttttacccgactggagcacgacatgataccggtgctccgcgacaga
ctgcgcgtccagccttctgccagtggcgatcgcgctggcattatcggtgctgctgcgctg
gctgagatcattctcgcgtcatcttcctga

DBGET integrated database retrieval system