KEGG   Methylovorus glucosotrophus: Msip34_2908
Entry
Msip34_2908       CDS       T00943                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
mei  Methylovorus glucosotrophus
Pathway
mei02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mei00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Msip34_2908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mei02044]
    Msip34_2908
Enzymes [BR:mei01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Msip34_2908
Secretion system [BR:mei02044]
 Type IV secretion system
  Trb secretion system protein
   Msip34_2908
SSDB
Motif
Pfam: T2SSE AAA_7 Zeta_toxin AAA_29 FtsK_SpoIIIE DEAD AAA_22 MMR_HSR1 AAA_16 Dynamin_N TniB ATPase AAA_19 GTP_EFTU AAA_30 ABC_tran TrwB_AAD_bind ResIII Septin Roc ABC_ATPase AAA_23 YqeC PduV-EutP
Other DBs
NCBI-ProteinID: ACT52132
UniProt: C6XES5
Position
pMsip01:complement(61737..62702)
AA seq 321 aa
MSNLSRLDETQRNRLNESLRRNLGVKILGALNDPNVIEIMLNPDNTVWFDYLGRGMEYSG
YTMPSSQAQLVLQDVASMLGQTVTKDNPVVEGELPLDGSRFEGLIPPIVAAPSFAIRKRA
SRVFTLDDYVDRNILTPEQAIFIRQSIRDKRNILVVGGTASGKTTLLNAFLDETAKVAPS
ERMVIIEDTVELQCPIKNIVQMRTSETMDMTKLLRVTMRMRPDRICVGEMRGKEALALLK
AWNSGHSGGFATIHADSTTDALLKLDEYVQEAGVPSKMGLISRAVHCVVFIEKSEGGRQV
KELARVVGYDRESNLPILEQV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtctaaccttagccgattggatgaaactcaacgcaacagacttaatgagtcattgcgg
cgaaacttgggtgtcaagattcttggcgctttaaatgatcccaatgtaattgagattatg
ctaaatcccgataatacggtttggttcgattatcttggtcgaggcatggaatattcaggc
tatacgatgccttccagccaggcgcaacttgtactccaagatgttgcatcaatgcttggg
caaacagttactaaagataatcctgtagttgaaggtgagcttccgttggatggatctcga
tttgagggtcttattcccccgattgtagctgctccatccttcgcaatccggaaacgtgca
agccgggtgttcacccttgacgattatgtagatcgaaatattctcactcctgagcaagcg
atctttatccggcaaagtattcgcgataaaaggaacattcttgttgttggaggtaccgca
tcggggaaaacaacccttctgaatgctttcctcgatgaaacggcaaaggttgctccttct
gaaaggatggtaattattgaagatacggtagagctacagtgcccaatcaaaaacattgtt
cagatgcgtacctctgagaccatggatatgacaaagctgctgcgcgttactatgcgaatg
cggccagatcggatctgcgttggtgaaatgcgagggaaagaggcattagccctacttaag
gcatggaattcaggccactcaggtggattcgcaacaattcatgcggactccaccactgac
gctcttttgaaacttgatgagtatgtccaagaggccggagtgccctcaaaaatggggttg
atatcacgcgccgtgcattgcgttgttttcatcgaaaaatcagaaggaggtagacaggtc
aaagaactggctagagtagttgggtatgacagagaatcgaatctaccgattcttgaacaa
gtataa

DBGET integrated database retrieval system