KEGG   Methylophaga nitratireducenticrescens: Q7A_1134Help
Entry
Q7A_1134          CDS       T02055                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00900  Terpenoid backbone biosynthesis
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q7A_1134
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Q7A_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NAD_binding_3 NmrA
Motif
Other DBs
NCBI-ProteinID: AFI83972
UniProt: I1XHV3
Position
1147442..1148632
Genome map
AA seq 396 aa AA seqDB search
MQHVTILGSTGSIGISTLDVLQRHPEKYRVFALAANKSVEGLFEQCLQFHPAMAVMLCPQ
SAEKLKTKLDAAGLMIEVQSGMQALERISSTEQTDIVVAAIVGAAGLLPTLAAAKAGKRI
LLANKEALVMSGALLMREVQANNAVLLPVDSEHNAIWQCMPVGETQQYQFENKGIRRIIL
TASGGPFRDWDIADLEAVTPEQAIAHPNWSMGQKISVDSATMMNKGLEVIEAHWLFGMPS
DKIEVVLHRQSIIHSMVDYLDGSVLAQMGNPDMRTPIANTLAWPERIDSGVEPLDLVKAG
RLDFAAADFGRFPCLALAYQALNIGGTSTAILNAANEVAVEAFLQKQIKFTDIARIIANV
LESVPATPADSLEQILSADKLAREAAQKQTKVLCNH
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgttactattctgggatcaaccggttccattggtatcagtacactggatgtt
ttgcagcgtcatcctgaaaagtaccgagtctttgcgctggcggccaataaatcagtagag
ggtttatttgaacagtgcctgcaatttcatcctgcaatggcggtgatgttgtgcccgcaa
tctgctgaaaaactaaaaaccaaacttgacgcagctggtttaatgattgaagtacaaagc
ggcatgcaggctctggagaggatttccagcactgaacaaacggatattgtggtcgccgca
atagtgggcgctgctggattactgcctaccctggcagcagctaaagcaggtaaaagaatc
ctgctggcaaacaaagaagccttggtcatgagtggtgcattactgatgcgagaagtacag
gcaaataatgctgttctgcttcctgtagatagcgagcacaatgctatatggcaatgtatg
ccggtgggtgaaacccaacaatatcagtttgaaaataaaggaattcgccgcattattttg
acggcttcaggtggtccatttcgtgattgggatattgctgatctggaagctgtaacaccc
gaacaggcgatagcgcatccaaactggtcgatgggacagaaaatatctgtggattcggcc
accatgatgaacaaaggtctggaagtcatcgaagcgcattggttgtttggtatgccaagt
gacaagattgaagttgtcctgcatcggcaaagtattattcactccatggtagattatctg
gacgggtcagtattggcgcaaatgggtaatcccgatatgcgcacaccgattgccaatacc
ctggcttggccagaacggattgattcaggcgtcgagcctttggatttggtgaaagcaggg
aggcttgattttgctgctgcggattttggacgattcccctgtctggcgttggcctatcag
gcattgaatatcggtggtaccagcactgccattcttaacgcggcaaatgaagtggcggta
gaagctttccttcaaaagcaaattaaatttactgatattgcccgtatcatcgctaacgtg
ctggaaagcgtaccagctacccccgctgattcgttggaacagattttgtctgccgataag
cttgccagagaggctgcccaaaagcagactaaggttttatgcaatcattaa

DBGET integrated database retrieval system