KEGG   Methylophaga nitratireducenticrescens: Q7A_124Help
Entry
Q7A_124           CDS       T02055                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mej  Methylophaga nitratireducenticrescens
Brite
KEGG Orthology (KO) [BR:mej00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Q7A_124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMPIT FapA MscS_porin EzrA AAA_13
Motif
Other DBs
NCBI-ProteinID: AFI82983
UniProt: I1XF14
Position
complement(124430..126079)
Genome map
AA seq 549 aa AA seqDB search
MEIKTLHKLEKQAYKKSHAEIARIGFALFFLAAILAYSFATSGGVPNNLFLAIAAVFGGY
MAMNIGANDVANNVGPAVGSKALTMGGAIMIAMIFEAAGAFIAGGEVVSTIKGGIIDIKQ
FGIDTETFVWAMMAALLAAALWLNLATVAGAPVSTTHSIVGGVMGGGMAAAGFGIVDWGT
MGAIVSSWIISPLMGGIIAAAFLLAIKKTIIFRDDKIQAAFRWVPIYVSVMAWAFSTYLV
IKGLNQVWGQFINSLNGLPLVDFAPQAKPSFFTAAVIGLLIGVLVFWIVKKSIGSNLPQM
KNDRASVNALFTIPLIFAAALLSFAHGANDVANAIGPLAAINDAIMSGGITDKAGIPLWV
MAVGALGIAIGLGLYGPRLIRTVGGEITELDQMRAYSIAMAAALTVIIASQLGLPVSTTH
IAIGGVFGVGFLREWLDESNKIERQIDREKAEIKDDKKMLNALRGELKKLEKKPSKTVDE
YQRITELYRLIEEEESSLKKAKKVLKKEKKNLFVKRDMVKKIVTAWVVTVPAAATLSACI
FFMIRGIML
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatcaaaacccttcataaacttgaaaaacaggcctacaaaaaaagccatgccgaa
atagccagaataggctttgcactttttttccttgctgccattctggcatacagttttgct
acttccggtggtgttcccaataatctgtttctggctattgccgccgtgttcggtggttat
atggcaatgaatatcggtgccaacgatgtggccaataacgttggcccagcggtgggctcc
aaggcgctgacgatgggtggcgccattatgattgcaatgatttttgaggctgctggcgcc
tttattgctggcggtgaagtggtgtcaaccattaaaggcggcatcattgatatcaagcaa
tttggtatcgatactgaaacctttgtctgggccatgatggccgcattattagcggctgct
ttatggcttaatctggcgaccgtcgccggagcgccagtatcaactactcactcgatagtg
ggcggcgtaatgggcggtggtatggctgccgccggcttcggtattgttgactggggcacc
atgggtgccattgtcagttcctggattatttcgccattgatggggggtattattgcagcc
gcttttttattggctattaagaaaaccatcatctttcgtgacgataaaattcaggccgcc
tttcgctgggtgccaatttatgtttcggtgatggcctgggcattttccacttacttggtg
attaaaggacttaatcaggtatggggacaatttattaattcacttaatggcctacctctt
gtggattttgctcctcaagccaaacccagtttttttactgcagcggtaataggcctgctg
attggtgttctggttttctggattgttaaaaaatctatcggcagcaacctgccacagatg
aaaaatgatcgtgccagtgtcaacgccctgttcactattcccttaatctttgcggctgcc
ttattgagctttgcccatggtgcgaatgatgtggcaaatgctatcggtcctctggccgca
ataaatgacgccattatgtcaggtggtatcaccgataaagccggtattccgctttgggtc
atggccgtgggtgcgttaggtattgccattggtttgggtctgtatggtccaagactgatt
cgtaccgtaggcggtgaaattaccgagctggatcagatgcgcgcctattcaatcgctatg
gctgctgctttgaccgtcatcattgccagccaactcggcttgccggtcagtacaacgcat
attgccattggtggggtattcggggtgggcttcctgcgtgaatggctggatgaatccaat
aaaatcgaacgccagattgatcgcgaaaaagccgaaatcaaagatgataaaaagatgctt
aatgcgttgcgcggtgaactgaaaaaactggagaaaaagccctccaaaaccgtggatgaa
tatcaacgtataacggagctttatcggttgattgaagaggaagagtcctcgctgaaaaaa
gccaaaaaagttctcaaaaaagaaaagaaaaacctgttcgtcaaacgcgatatggtgaaa
aagattgttacagcgtgggtggtcaccgttccagcagcggcaactttatcagcctgcatc
ttctttatgattagaggcatcatgctgtaa

DBGET integrated database retrieval system