KEGG   Methylophaga nitratireducenticrescens: Q7A_1396Help
Entry
Q7A_1396          CDS       T02055                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00040  Pentose and glucuronate interconversions
mej00052  Galactose metabolism
mej00500  Starch and sucrose metabolism
mej00520  Amino sugar and nucleotide sugar metabolism
mej01100  Metabolic pathways
mej01130  Biosynthesis of antibiotics
Module
mej_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7A_1396 (galU)
   00052 Galactose metabolism
    Q7A_1396 (galU)
   00500 Starch and sucrose metabolism
    Q7A_1396 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Q7A_1396 (galU)
Enzymes [BR:mej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Q7A_1396 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFI84226
UniProt: I1XIK7
Position
complement(1400021..1400878)
Genome map
AA seq 285 aa AA seqDB search
MAVKSLIRKCLFPAAGYGTRFLPATKAMPKEMLPIVSKPLIQYGVEEAMEAGISQIGFIT
GRGKRAIADHFDTSFELEHQIKGTSKEKFLDDIRYLMDNCEFVFMRQREMLGLGHAILTG
EPMIGNEPFAVILADDLCAKPDEGGERALSQLVALYERYQCSIVAIEEVPADETHSYGVI
SGDEIAPGIYQIKDMVEKPKPEEAPSNLAIIGRYILTPEIFEYLRKTKPGTNGEVQITDA
LRLLAKDRLVLAVKFKGRRFDCGSVEGFVEATNYYYEHEHLNKLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaaagtcttataagaaaatgtttattccctgcggcaggttatggcacacga
tttcttcctgcaacaaaagcaatgcccaaagaaatgttaccaattgtcagtaaacctttg
attcaatatggtgttgaagaagcgatggaggcgggtatttcacaaattggttttattacc
ggccgcggtaaacgggccattgccgatcatttcgacaccagtttcgaactggaacatcaa
attaaaggtacctcaaaagaaaaatttctcgacgatattcgttatctgatggataactgt
gaatttgtatttatgcgccaacgggaaatgttaggtttgggtcatgccatcctgacaggc
gagccgatgattggcaatgagccttttgcggtcattctggctgacgatttatgcgccaaa
ccggatgaaggcggtgaacgtgctctgagtcaattggttgcattatatgaacgttatcag
tgcagcatcgtcgcgattgaggaagtccctgctgatgaaacccatagttatggtgtcatt
tccggtgatgaaatcgctccgggtatttatcaaataaaagacatggttgaaaaacccaaa
cctgaagaagcccccagcaatctggcaattatcggacgctatattctgacaccggagatt
tttgaatatctgcgaaaaaccaaacccggcaccaatggcgaggttcaaataaccgatgcc
ctgcgtttgctggcaaaggatcgactggttttagctgttaaatttaaaggtcgtcgtttt
gattgcggcagcgtcgaaggttttgttgaagcgacaaactattattacgaacatgagcat
ttgaataaattagcgtaa

DBGET integrated database retrieval system