KEGG   Methylophaga nitratireducenticrescens: Q7A_1484Help
Entry
Q7A_1484          CDS       T02055                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej01040  Biosynthesis of unsaturated fatty acids
mej01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Q7A_1484
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Q7A_1484
Lipid biosynthesis proteins [BR:mej01004]
 Desaturase
  First
   Q7A_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF2975 DUF624 DUF456 Keratin_assoc
Motif
Other DBs
NCBI-ProteinID: AFI84311
UniProt: I1XIU2
Position
1493968..1494900
Genome map
AA seq 310 aa AA seqDB search
MKFIRHWFDNGEPRVSSAEYDKSDTGVDWLRVIPFIVMHLACLTVLFVGVSTVAVVTAIT
LYLLRMFAITAFYHRYFSHKAFRTSRKIQFIFALIGASATQRGPLWWAAHHRQHHRYADQ
PADPHSPKQGFFWSHMGWFLSGKHYQADYNLVQDWKRFVELRWLDRFDLIAPVLLALTLF
IFGVLLEKFAPELKTSGWQMLVWGYFISTVVLLHVTLLINSMAHRIGKKRYTTNDESRNN
FLLALLTLGEGWHNNHHHYPASARQGFYWWEVDVSYYLLKLMQKSGLIWDVRTVPLHKRD
SKKIIPEADL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattcgacattggtttgataatggtgaaccccgggtttcttctgctgagtat
gacaagtcagatactggtgttgactggctcagagtcattccttttatcgtgatgcatttg
gcttgtctgaccgttttatttgtgggcgtttccactgttgctgttgttacggcaataaca
ttatatttattgagaatgtttgccataacagcattttatcatcgttatttttcacataaa
gcctttagaacttcgcgaaaaatccaatttatctttgccttgattggcgccagtgcaaca
caacgaggccctttatggtgggcggcacaccatcgtcagcatcatcgctatgcagatcag
cctgccgatccccattcccccaagcagggctttttttggagtcatatgggctggtttctt
tcaggaaaacattatcaggctgattataatctggttcaagactggaaaagatttgtcgag
ctacgttggctggatcggtttgatttaattgctccggttctattggctttaaccttattt
atctttggtgtattactggaaaagtttgcacccgaattgaaaaccagcggttggcaaatg
ttagtgtggggctatttcatttcaacggtagtgttattacacgtcacgttgttgataaat
tccatggcgcaccgaattggtaaaaaacgatacacaacaaacgatgaaagtcgtaataat
tttctgttggcattacttactctaggagaaggttggcacaataatcaccatcattacccg
gcttccgccagacaaggcttttattggtgggaagtcgatgtaagttactacttattaaag
ctaatgcaaaaatcagggctcatctgggacgttcgcacggtgccacttcataaacgtgat
tccaagaaaatcattccggaggctgatttatga

DBGET integrated database retrieval system