KEGG   Methylophaga nitratireducenticrescens: Q7A_290Help
Entry
Q7A_290           CDS       T02055                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mej00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q7A_290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mej01007]
    Q7A_290
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mej03016]
    Q7A_290
   03029 Mitochondrial biogenesis [BR:mej03029]
    Q7A_290
Enzymes [BR:mej01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Q7A_290
Amino acid related enzymes [BR:mej01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Q7A_290
Transfer RNA biogenesis [BR:mej03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Q7A_290
 Prokaryotic Type
   Other AARSs
    Q7A_290
Mitochondrial biogenesis [BR:mej03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Q7A_290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1g Ceramidse_alk_C
Motif
Other DBs
NCBI-ProteinID: AFI83148
UniProt: I1XFH9
Position
complement(301514..303277)
Genome map
AA seq 587 aa AA seqDB search
MKDQLKELIESALASLIAQQSLPADVSSADVQLERTKDRSHGDFASNIAMVLAKPAKMNP
RQIATLIVDALPQHEMIEKVEIAGPGFINFSLSASSRQQVVADVLKKAGQFGLSNYGNGQ
KVQVEFVSANPTGPLHVGHGRGAAYGSVVSSLLKAVGFDVHREYYVNDAGRQMDILATSV
WLRYLEKCGEQFTFPSNGYRGEYVLDIAETLKQQHGNALLHPVSLVFDGVPADEPQGGDK
ELHIDGLTQQAKHLLGADVYRQLFDLGLNAILDDIRNDLAGFGAEYDEWFSERSLVESGV
VDKAVEQLKDANMLYQQDGAWWFKSTDFGDEKDRVVVRDNGQATYFASDVAYHLNKFNRG
FDQIIDIWGADHHGYITRVKASMEGLNQDVSKLKVLLVQFAVLYRGKEKVGMSTRSGEFV
TLRELRDEVGKDAARFFYVMRGADQHMDFDLELAKSQSNDNPVYYVQYAHARVCSVFRQL
AERQLNWDEQTGLQNLSLLTEEHEQALFTMLSRYPEVVELAAITHTPHLLAHFLMDLARD
FHTYYNAHQFMTDNIELSQARLTLITAVRQVIANGLGLMGVSAPQSM
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaccaattaaaagaacttattgaaagtgctttagcttcgttgattgcccaacaa
agccttcctgcagatgtttcatcggctgatgttcagctggagcgaaccaaagatcgcagt
catggtgatttcgccagtaatattgcgatggtattagccaagcctgccaaaatgaatcct
cggcagatagcgacattgatagttgatgcgcttccacagcatgaaatgatcgagaaagta
gaaattgccggtccagggtttattaatttcagcttatccgctagctcaagacagcaggta
gtggcagatgtcttgaaaaaagccggtcaatttggtctgagcaattacggcaatggtcag
aaagtccaggtggagtttgtttcggccaatccaaccggaccactgcatgtaggccatgga
cgtggcgcagcatatggttcagtagtcagcagcttgttaaaagccgtagggtttgatgtt
caccgtgaatattacgtaaatgatgccggccgtcagatggatattctggccaccagcgtc
tggctgagatacctggaaaaatgtggtgagcagtttactttcccaagtaacggttatcgt
ggtgaatatgtcttagatattgctgaaacattaaaacaacagcatggaaatgcattgtta
catccagtatctctggtttttgatggtgttccggcggatgaaccccaaggtggtgataaa
gagctgcatatagatgggctgacacaacaggccaaacatcttctcggtgcagatgtgtat
cgtcagctgtttgatttgggcctcaatgccattctggatgatattcgtaatgatttggct
gggtttggtgccgaatacgatgaatggttttctgagcgttcactggtggaatccggtgtg
gttgataaagctgttgaacaactgaaagacgccaatatgctttatcagcaggatggtgcc
tggtggttcaaatccactgattttggcgatgaaaaagaccgggtggtggttcgtgacaat
ggtcaggcaacctatttcgcttctgatgttgcttatcacctgaataaattcaatcgcggc
tttgatcagattattgatatctggggcgccgatcatcatggatacattacgcgggttaaa
gcctccatggaagggctgaatcaggatgtcagcaagctgaaagtcttactggtacagttt
gctgtgttgtaccgtggtaaagaaaaagtcggtatgtcgacgcgtagcggagagtttgtc
acattacgcgaactacgtgacgaagtcggtaaagatgctgcccgtttcttttatgtgatg
cgcggtgctgaccagcatatggattttgatcttgaactggcaaaatcacaaagtaatgat
aatccggtatattacgttcaatatgctcacgcacgtgtctgcagtgttttccgtcaactg
gcagaaaggcagctgaactgggatgaacagacaggattacagaatctgtctttattgact
gaagagcatgaacaggctttgtttaccatgttgtcacgttatcccgaagtagtggaactg
gcagctataacgcataccccccatttattggcgcatttcctaatggatttggcacgtgat
tttcacacctactacaatgctcaccagtttatgacagataatattgagttaagtcaggca
cggctgacgctgatcaccgccgtcaggcaggttattgccaatggtcttgggttaatgggc
gtttcagcgccacaatcaatgtaa

DBGET integrated database retrieval system