KEGG   Methylophaga nitratireducenticrescens: Q7A_2963Help
Entry
Q7A_2963          CDS       T02055                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00010  Glycolysis / Gluconeogenesis
mej00052  Galactose metabolism
mej00500  Starch and sucrose metabolism
mej00520  Amino sugar and nucleotide sugar metabolism
mej00521  Streptomycin biosynthesis
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01120  Microbial metabolism in diverse environments
mej01130  Biosynthesis of antibiotics
mej01200  Carbon metabolism
Module
mej_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q7A_2963
   00052 Galactose metabolism
    Q7A_2963
   00500 Starch and sucrose metabolism
    Q7A_2963
   00520 Amino sugar and nucleotide sugar metabolism
    Q7A_2963
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q7A_2963
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Q7A_2963
Enzymes [BR:mej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Q7A_2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AFI85738
UniProt: I1XMW9
Position
complement(2765303..2766283)
Genome map
AA seq 326 aa AA seqDB search
MQTLLAADIGGTKTLLQLSHLDGEVILQQRLENDDYADFESLLTVFFASVAVDFLPVSSA
CFAVAAPLSGCRVQLTNRPWIIDSDKLQQQFPLADLCLVNDFAAVGHGIGELEENDLIVL
QQGKPEAKSLRAVIGAGTGLGQAILSPLHKSWRVWPTEGGHTDFAAQDIQQQALLNKLFE
QFEHVSYERVLSGSGLVMLYQFIADQQGNNTTLNLTAEQISQSALQKTDPAAVKAMQLFM
QIYGAQAGNLALTTLPRAGIFIAGGIAVKNLALFEQGFFMQSFLAKGRMRGVLEQIPVYL
INNPDVGLLGARLLARKALYNVDHDR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctgttagctgcagatatcggcggcaccaaaaccttgttgcaactcagtcat
cttgatggtgaggttatcctgcaacaacgattagagaatgatgattacgcagattttgaa
agtctgctgacagtttttttcgctagtgtagccgtcgattttctgccagtcagtagtgca
tgttttgccgtggcagcaccgttgagtggatgccgtgtgcaactgacgaatcgaccctgg
attatcgatagcgataagctgcagcagcagtttccacttgctgatctttgcctggtcaat
gactttgccgcggttggtcatggtatcggtgaacttgaagaaaacgatctcattgtgctg
cagcaaggtaagccggaagccaaatcattacgagcagtcattggtgcgggtaccgggttg
gggcaggctattctgtcacctctgcataaaagctggcgggtatggccaacagaaggcggg
cataccgactttgctgctcaggacatccagcagcaagccttattgaataaactatttgaa
caatttgagcatgtctcctacgagcgggtattatccggctccggcctggttatgctgtac
cagtttattgccgaccagcaaggtaataacactacgttgaatttaacggcagaacagata
agtcagtctgctctgcaaaaaacagatcctgcggcagtaaaagccatgcagttatttatg
cagatttacggagctcaggcgggtaatctggcgctgacgaccttgcccagagccggaatt
tttatcgcaggggggattgcagtaaagaatctggccttatttgaacagggctttttcatg
cagtcttttctggcgaagggcaggatgcgtggggtgctggagcagataccggtgtatttg
atcaacaatcctgatgtgggactccttggagcacgtttgttggctcgaaaagcgttgtat
aatgttgaccatgaccgataa

DBGET integrated database retrieval system