KEGG   Methylophaga nitratireducenticrescens: Q7A_3063Help
Entry
Q7A_3063          CDS       T02055                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00260  Glycine, serine and threonine metabolism
mej00750  Vitamin B6 metabolism
mej01100  Metabolic pathways
mej01110  Biosynthesis of secondary metabolites
mej01120  Microbial metabolism in diverse environments
mej01230  Biosynthesis of amino acids
Module
mej_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mej00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q7A_3063
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Q7A_3063
Enzymes [BR:mej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Q7A_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFI85836
UniProt: I1XN67
Position
complement(2856815..2857960)
Genome map
AA seq 381 aa AA seqDB search
MPFRPRYTGLIDRYRDRLPVNDDTRLISLGEGNTPLLKLNNIPKLIGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGITAFVIIPDGKIAQG
KLAQAMMHNAVVIQIKGNFDEGMQLVKDVAEHAPVTIVNSINPYRLQGQKTAAFEIIEEL
GRAPDYHCLPVGNAGNITAHWIGYCEYSSASGDHVTEACAYCHGNCKYAGGAIVGNRPKM
VGYQANGSAPFMRGAMVDDPETVATAIRIGHPQSWDMAWKVKEESQGWFDECSDEEILAA
QKLLAEKEGIFCEPASATSVAGALRDIQSGKIPEGSTVVCTLTGHGLKDPDIAIKQSSSP
VITVDATLDSVRDAIINNLAR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgtccacgttataccggcctgattgaccgctatcgtgaccgtttgccggtc
aatgatgacaccagactgatcagtcttggtgaaggtaatacaccattattgaaattgaac
aatatccccaaattaattggcaaagatgttgatatctacgtcaaatatgaaggattgaat
cctacgggttctttcaaagatcgtggtatgaccatggcagtgaccaaagctgtggaagag
ggaagtaaagccattatttgtgcttctactggtaatacctcagcagcagcggctgcctat
gctgcacgtgctggtatcactgcttttgttattattcctgatggcaaaattgcccagggt
aaattagctcaggccatgatgcacaacgcagtggttatccaaatcaaaggcaattttgat
gaaggcatgcaactggttaaagatgttgcagagcatgcaccagtcaccattgtaaattcg
attaatccttatcgtttgcaaggtcagaaaactgctgcgtttgagatcattgaagagtta
ggtcgtgcgccggattatcactgcttgccagtcggtaacgctggtaatatcaccgcacac
tggattggctactgtgagtattcctcagccagtggtgatcatgtcactgaagcctgcgcg
tactgtcatggcaattgtaaatatgctggtggtgcaattgtgggtaaccgccccaaaatg
gtgggttatcaggctaatggcagtgcaccgtttatgcgtggtgcgatggttgatgatcct
gaaacagtggctaccgcgattcgtattggtcatccacaaagctgggatatggcctggaaa
gtgaaagaagaatcacagggttggtttgatgagtgctctgatgaagaaatattggctgcc
cagaaattactggcagaaaaggaaggtattttctgtgagccagcttcagcaacttccgtt
gctggggcattacgtgatattcagtccggcaagattcctgaaggcagtaccgttgtgtgt
acgttgacaggtcacggcctgaaagatccggacattgcgatcaaacaaagtagttcacct
gtgattactgttgatgctacattggactcagtacgtgatgcgattatcaacaacttggcc
agataa

DBGET integrated database retrieval system