KEGG   Methylophaga nitratireducenticrescens: Q7A_871Help
Entry
Q7A_871           CDS       T02055                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mej  Methylophaga nitratireducenticrescens
Brite
Enzymes [BR:mej01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Q7A_871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_23 Methyltransf_11 Methyltransf_4 CMAS NodS MTS Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AFI83713
UniProt: I1XH44
Position
883804..884619
Genome map
AA seq 271 aa AA seqDB search
MPWSFPGHQLRLPARGCLSADICYAEAVAPLIERSYPNRLIKKHAANTQELPMTFTMNQA
HSNMVWQQVRPNEVSHPEVLKALQQIDRAQFVSDDYKALAYSDTRLPIGCGQFMWTPLEE
GRILQFLQLKPSDSVLEVGTGSGFFTALIAGLSSNVISIEYFAELSALAGSRLEAADIQN
VNLVCGDASHGWKLTDRIDVIVLTASCQQVPEDFLHALKVGGHLVIITGQAPAMQVQRIT
RTGEWLWQTETLFETVVAPMVHAEKKPEFIF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgccatggtcatttcccggtcatcaacttcgcttgccagctaggggctgtttatcagct
gatatctgctatgcagaagcggttgcaccgcttattgaaaggtcatatcctaaccgattg
ataaaaaaacacgcggcaaacactcaggaattacccatgacattcaccatgaatcaagca
cattccaatatggtttggcaacaagttcgacctaatgaagtttcccatccagaagtactg
aaagcattacagcaaattgatcgggcacaatttgtctctgatgattataaagcgctggcg
tattcagacacgcgtttgccgattggttgtggtcagtttatgtggacaccgctggaagaa
gggcggattttgcaatttttacaattgaagccatcagattcggtgctggaagtcggtacc
ggtagtggtttttttacagcattgatcgccggactgtcatcaaatgtcattagcatagaa
tattttgccgaactgtctgcgttggctggttcacgtttggaagctgcagacatacaaaat
gtaaacctggtgtgtggtgatgcaagtcatggttggaagctgacagatcgcattgatgtt
atcgtcttgacggccagttgccagcaggttccggaagattttcttcatgcgctcaaagta
ggggggcatttagtgattattaccggtcaggcacctgcgatgcaggtacagcgtattact
cgtaccggcgagtggttatggcaaacggagactttatttgaaacggtggtggcacccatg
gtgcatgctgaaaaaaaacctgagtttatcttttaa

DBGET integrated database retrieval system