KEGG   Methanosarcina sp. Kolksee: MSKOL_0274Help
Entry
MSKOL_0274        CDS       T03821                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G
  KO
K00583  tetrahydromethanopterin S-methyltransferase subunit G [EC:2.1.1.86]
Organism
mek  Methanosarcina sp. Kolksee
Pathway
mek00680  Methane metabolism
mek01100  Metabolic pathways
mek01120  Microbial metabolism in diverse environments
mek01200  Carbon metabolism
Module
mek_M00357  Methanogenesis, acetate => methane
mek_M00567  Methanogenesis, CO2 => methane
mek_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mek00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSKOL_0274
Enzymes [BR:mek01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSKOL_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrG TIM
Motif
Other DBs
NCBI-ProteinID: AKB46051
UniProt: A0A0E3LIH9
Position
318960..319178
Genome map
AA seq 72 aa AA seqDB search
MDGKAPAAFVEPGEFNEVMKRLDKIDEKIEFVNSEVAQKIGKKVGRDIGILYGGFIGLLL
FLIYTVVSSMFM
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaagcaccagcagcatttgtagagccaggtgaatttaacgaagtaatgaaa
aggctcgataagatcgatgaaaagattgagtttgtcaacagtgaagttgcgcaaaaaatc
ggaaagaaagtaggaagggatattggaattctgtacggcggatttattggcctgctgctc
ttcctgatatataccgtggtatcatcaatgttcatgtaa

DBGET integrated database retrieval system