KEGG   Methanosarcina sp. Kolksee: MSKOL_0275Help
Entry
MSKOL_0275        CDS       T03821                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mek  Methanosarcina sp. Kolksee
Pathway
mek00680  Methane metabolism
mek01100  Metabolic pathways
mek01120  Microbial metabolism in diverse environments
mek01200  Carbon metabolism
Module
mek_M00357  Methanogenesis, acetate => methane
mek_M00567  Methanogenesis, CO2 => methane
mek_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mek00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSKOL_0275
Enzymes [BR:mek01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSKOL_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: AKB46052
UniProt: A0A0E3Q8D8
Position
319192..320142
Genome map
AA seq 316 aa AA seqDB search
MFKFDKKQEVFEIGGVKFGGQPGENPTVLVSTMFYARHKIVTDEDKGIFDRAAAETLWNT
QVSLSDATGLPYVNQIVGETPEAIKRYIDWFIEIDDRTPFLIDSSAGNVRAAAAQYCTEI
GVADRAIHNSINASIEQEEIDILTESDVSAAIVLAFNATDPTVKGKVDILEVGGSGQTKG
MLQVGEECGIKYPIIDVAAMPLGAGSGATIRSIPTLKAKFGLPIGGGYHNMASAWDWLRK
FKKTQPDPKAIYMPADIGTNLVALIAGSDYLLYGPIENVNQIFPAVAMVDIMLGETAKEL
GVEIADLENHPVTKLT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtttgacaagaaacaggaagtttttgaaataggtggagttaaattcggtgga
cagccgggtgaaaacccaaccgtattagtcagtactatgttctatgcaaggcacaagatt
gtgaccgatgaagataagggtatcttcgacagggcagctgcagaaaccctctggaacacc
caggtctcactgagcgacgccacaggtctcccctatgtgaaccagattgtaggagaaact
cctgaagcgatcaagcgctatatcgactggttcattgagattgacgacaggacacctttc
ctgatcgactcctcagctggaaatgtgcgtgcagccgcagctcagtactgtactgaaata
ggtgttgcagacagggcaatccacaactcgatcaacgcaagtattgaacaggaagaaatc
gatattctcacagaaagcgacgtatcagctgcaatcgttcttgccttcaatgcaaccgac
ccgaccgtaaaaggaaaggtagatatccttgaagtcggcggttccggacagaccaagggt
atgctccaggtcggagaggaatgtggaataaagtatcccattatcgatgttgcagccatg
cctcttggtgcaggctcaggtgcaacaatccgttcgatacccacactgaaagcaaaattc
ggattgccaattggtggtggataccacaacatggcttctgcatgggactggctccgcaaa
ttcaagaagactcagcctgaccccaaggcaatctacatgcctgcagatattggtaccaac
ctggtggctctgattgcagggtccgactacctgctctacggtccaatcgagaacgtaaac
cagattttcccggctgttgcaatggtagacatcatgctcggtgaaactgcaaaggaactt
ggtgtcgagatcgcagacttggaaaaccacccggtaaccaagttgacataa

DBGET integrated database retrieval system