KEGG   Methanobacterium lacus: Metbo_0709Help
Entry
Metbo_0709        CDS       T01437                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mel  Methanobacterium lacus
Brite
KEGG Orthology (KO) [BR:mel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Metbo_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMEM141
Motif
Other DBs
NCBI-ProteinID: ADZ08960
UniProt: F0TAT4
Position
complement(679727..680710)
Genome map
AA seq 327 aa AA seqDB search
MDWLLIIGVITAMYMAFNIAANDIGNSMGTVVGSGALTMRKALIVGALFEFLGAMFLGSS
VIKTVGSGIVPLEFMTGLGAFIITMSAGIWITITLIKKIPISGSDAIVSSVLGYGLVYAG
VNHLNWGTIGFIMASWVISPLIGLASGFLVYYLLKLGILNRIKSNIGAKDRAEKVFSYLQ
IGSSSFAALGVGAIDIAAATAVLYVTVGATIGFSIKFLGAIALVFGILIAGNRITDTIGR
RITELVPTRGFSAQISAGSITLLFASIGMPISPTQTLVGSVIGVGMARGTSTVKLDVIKH
IATTWVITIPACIAISATLYFVINAIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggattggttattgataataggcgttattaccgccatgtacatggcttttaacattgca
gccaacgatattggaaattccatgggtaccgttgttggaagcggagcccttacaatgcgt
aaagcactcatagttggagctttgttcgaatttttaggtgctatgtttctgggtagtagt
gtaattaagaccgtgggaagtgggattgtacccctagaatttatgactggtttaggtgcg
tttataataaccatgtctgcaggaatatggataacaattaccctaattaaaaaaatacca
atttctggttctgatgccatcgtgagttctgtgcttggttatggtttggtttatgcaggt
gtgaatcatcttaactggggtacaattggctttattatggcaagctgggtaatttcaccg
ttgattggtctggcatcgggatttttagtctactaccttctaaaactgggaattttaaac
aggataaaaagcaatatcggagctaaagatcgtgctgaaaaagtattttcatatcttcaa
attggaagttcttcctttgctgcattgggggttggagccatagatattgcggctgcaaca
gctgtgctctatgttactgttggtgccacaattggattttcaattaaatttttaggagcc
atagctttggtgtttggtattcttatagcaggaaacagaattacagacaccataggaaga
aggattactgagttggttccaactcgtggtttttcagcacaaatttcagcaggcagtatt
acactactctttgcatccattgggatgcccatctctcctactcaaacccttgtgggttca
gtgataggtgtgggtatggcaaggggaacttcaacagttaaactcgatgtcatcaaacat
atcgccaccacatgggtgataaccatacctgcttgtatagcaatatctgcaacattgtac
ttcgtaatcaatgctattttctaa

DBGET integrated database retrieval system