KEGG   Methanobacterium lacus: Metbo_0904Help
Entry
Metbo_0904        CDS       T01437                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mel  Methanobacterium lacus
Pathway
mel00521  Streptomycin biosynthesis
mel00523  Polyketide sugar unit biosynthesis
mel01130  Biosynthesis of antibiotics
Module
mel_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Metbo_0904
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metbo_0904
Enzymes [BR:mel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Metbo_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADZ09153
UniProt: F0TBS6
Position
884415..884972
Genome map
AA seq 185 aa AA seqDB search
MGKFKFIETSIDDVYIIEPTVFGDDRGYFMETYHQGEFKEAGLDMEFVQDNQSRSVRGVL
RGLHFQYTQPQGKLVRVIKGTVFDVAVDLRENSPTYGQYESVVLSEENKKQFYVPEGFAH
GFLVLSDVAEFTYKCTAFYNADDEGGIMWNDPDINIEWPLKEAGNVVLSDKDSEWKPLKE
TNVKY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatttaaatttatagaaacatccatcgatgatgtttacatcattgaaccaaca
gtttttggagatgatcgtggttacttcatggaaacctatcatcaaggtgaatttaaagaa
gcaggactagatatggaatttgtccaagacaaccaatccagatctgtacggggtgtttta
aggggacttcacttccagtacacccaaccacagggtaaactcgtgagggtgataaaggga
actgtgttcgatgttgcagtagatctaagggagaattctccaacctatggtcagtacgaa
tcagttgtgttatcagaagaaaataaaaaacagttctatgttccagaaggttttgcccat
ggatttctggttttatctgatgtggctgagttcacctacaaatgcacagccttttacaac
gctgatgatgagggaggcataatgtggaacgatccagacataaacatagaatggcccctg
aaagaagctggaaatgttgttttatcagataaagacagtgaatggaaaccattgaaagaa
accaatgtaaaatattag

DBGET integrated database retrieval system