KEGG   Methanobacterium lacus: Metbo_2070Help
Entry
Metbo_2070        CDS       T01437                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mel  Methanobacterium lacus
Pathway
mel00300  Lysine biosynthesis
mel00680  Methane metabolism
mel01100  Metabolic pathways
mel01110  Biosynthesis of secondary metabolites
mel01120  Microbial metabolism in diverse environments
mel01210  2-Oxocarboxylic acid metabolism
mel01230  Biosynthesis of amino acids
Module
mel_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mel00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Metbo_2070
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Metbo_2070
Enzymes [BR:mel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Metbo_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: ADZ10289
UniProt: F0TBU7
Position
complement(2113556..2114800)
Genome map
AA seq 414 aa AA seqDB search
MNITEKILARAAGKEEVHPGEIIEVDVDLAMAHDGTSPPTINNFKKIQDKVWDPEKIVII
CDHTVPPNTIGSAEFHKVSREFARDQGIKNYLNHGEGICHQVLPEYGFVKPGEVVVGADS
HTCTHGAFGAFATGVGATDMAFIFATGQTWFRVPEAYKITVDGKLGNFVSAKDVILNVIG
EIGTYGATYKSLEFCGNTIENMDVAGRMTICNMAIESGAKNGIMEPNKATLQYLKDRNVK
GFDVVTSDPDYTYEKEYFFDVDDMEPQVACPHNVDNVKPLSKVTGKTINQAFIGSCTNGR
MEDLVAAAEVLEGKRVHPDVRLLIIPASAEIYRKAINSGLVDIFMDSGAIICNPGCGPCL
GGHMGVLAAGEVCVATTNRNFLGRMGDPESEVYLANPAVVASSALSGEINDPRD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacagaaaaaatactggccagggctgcgggtaaggaagaggtacaccccgga
gaaataatagaagttgatgtggatcttgcaatggcacacgatgggacatccccacccaca
ataaacaacttcaaaaagatccaagacaaggtctgggatcctgagaagatagtcataata
tgtgaccatacagtgcctcccaacaccataggatcagcagaatttcacaaggtttcaagg
gaatttgcaagggatcagggaattaaaaattatttaaatcatggtgaaggaatatgccat
caagtacttccagagtacggtttcgttaaaccaggcgaagtggttgtaggagcagattcc
cacacatgcacccacggggcatttggagcatttgcaactggagtcggagcaacagacatg
gcatttatttttgcaactggacaaacatggttcagagttcctgaagcctacaaaattaca
gttgatggaaagttaggtaactttgttagcgccaaggacgttattttaaatgtgataggt
gaaattggaacctacggggcaacctataaatcactggaattctgtggaaataccatagaa
aacatggatgttgcaggtagaatgaccatatgcaacatggcaatagaaagcggtgcgaaa
aatggaataatggaacctaacaaagccaccctacagtacctgaaggatagaaatgtaaaa
ggctttgatgttgtaacatcagaccctgattacacttatgaaaaggaatacttctttgat
gtggatgacatggaaccacaagtggcatgtccacacaacgtggataatgttaaacccctg
tccaaagtcactggaaaaaccatcaaccaggcattcataggttcatgtaccaatggaagg
atggaagatctcgtggctgcagctgaagttctggaaggaaaacgtgttcatcccgatgtc
agacttctcataataccggcatcagctgaaatatacagaaaagctattaacagtggatta
gtagacatattcatggattcaggggcaataatctgcaaccctggatgtggaccctgtctt
ggagggcatatgggtgtgcttgcagcaggcgaagtttgtgtagcaacaaccaacagaaac
ttcctgggaagaatgggagaccccgaatctgaggtttaccttgcaaatcctgcagtggta
gcatcttcagcactcagtggtgaaataaacgatccaagggattaa

DBGET integrated database retrieval system