KEGG   Methanobacterium lacus: Metbo_2278Help
Entry
Metbo_2278        CDS       T01437                                 

Definition
(GenBank) methyl-coenzyme M reductase, beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mel  Methanobacterium lacus
Pathway
mel00680  Methane metabolism
mel01100  Metabolic pathways
mel01120  Microbial metabolism in diverse environments
mel01200  Carbon metabolism
Module
mel_M00356  Methanogenesis, methanol => methane
mel_M00357  Methanogenesis, acetate => methane
mel_M00567  Methanogenesis, CO2 => methane
mel_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mel00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Metbo_2278
Enzymes [BR:mel01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     Metbo_2278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: ADZ10492
UniProt: F0TCV2
Position
2313472..2314803
Genome map
AA seq 443 aa AA seqDB search
MPTYEDKIDLYGVNGKLLESDVPLEAVSPMVNPTIGKIVYDVKRSVAVNLAGIEKSLEKA
AYGGKSNFIPGRELKLDLKGNVDVLSEKIEKIIKIDEDDDFNLKLINGGDQMLVQMPAQR
INRAADYTVSTLVAGGAVVQAIIDTFDVDKFDASAVKTAVLGRYPQSVDFMGANVSALLG
PPVMLEGLGYGLRNIMANHVVAITKKNTLNAVALSSILEHTAMFETGDALGAFERSHLLG
MAYQGLNANNLVFDLVKENGKGTVGTVIATLVERAIDDGVIKVAKTMPSGYKVYEPNDWA
LWNAYAAAGLIASVIVNIGASRAAQGIASTLLYFNDIVEYETGLPGVDFGRAQGTGVGMS
FFSHGIYGGGGPGTFHGNHVVTRHSKGYVTPCNAAAMCLDAGTQMFSVESTSGLIGTVYG
DIDYFNQPVKYVADGAKEVKDII
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgtatgaagataaaatagacctatacggggtaaatggaaagcttttagaatca
gatgtacctttagaagctgtcagtccaatggtaaaccctactattggtaaaatcgtatat
gatgtaaaacgatccgttgctgtaaacttagccggaattgaaaaatctctggaaaaggca
gcatatggtggtaaatccaattttatccctggaagggaattaaaactagatcttaagggt
aatgtagatgtattatccgaaaagatcgagaagataattaagatcgacgaagatgatgac
ttcaacttgaagttaatcaacggcggagatcagatgcttgtgcagatgccagctcagaga
ataaacagggcagcagattacacagtttccacactagttgcaggtggagcagtagtccag
gcaataatagacacattcgatgtggacaaattcgatgcatcagcagttaaaacagcagta
ttaggaaggtaccctcagagtgttgatttcatgggtgcaaacgtttctgcattattagga
ccacctgtaatgcttgaaggacttggttacggtctaaggaacatcatggctaaccatgtt
gttgcaattaccaagaaaaacacccttaacgcagtagctttatcctcaatcctagaacac
accgcaatgttcgaaactggtgatgcattaggtgcattcgaaagaagccacctattaggt
atggcttatcagggattaaacgcaaacaacctagtgttcgacctagttaaagaaaatggt
aagggaacagtaggtacagttattgcaacattagttgaaagggcaattgacgatggcgtc
attaaagtggccaaaacaatgccttcaggttacaaagtttacgaaccaaatgactgggca
ctatggaacgcatatgccgcagcaggtctcatagcatcagtaatagttaacataggtgcc
tcaagggcagctcaaggaatagcttcaacactcctctatttcaacgacatagtggaatac
gaaactggacttccaggtgttgactttggaagagcacagggaactggtgttggaatgagt
ttcttctcccacggtatttatggtggtggaggtcctggaactttccacggtaaccacgta
gttacaagacacagtaaaggttacgtaaccccatgtaacgcagctgcaatgtgtttagat
gcaggaacccagatgttttcagtggaatctacctctggattaataggtactgtgtatggc
gacattgattatttcaaccagccagttaaatacgtagccgatggagctaaggaagtcaaa
gatattatttaa

DBGET integrated database retrieval system