KEGG   Methanobacterium lacus: Metbo_2379Help
Entry
Metbo_2379        CDS       T01437                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mel  Methanobacterium lacus
Pathway
mel00010  Glycolysis / Gluconeogenesis
mel01100  Metabolic pathways
mel01110  Biosynthesis of secondary metabolites
mel01120  Microbial metabolism in diverse environments
mel01130  Biosynthesis of antibiotics
mel01200  Carbon metabolism
mel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metbo_2379
Enzymes [BR:mel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Metbo_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C Semialdhyde_dh TrkA_N GFO_IDH_MocA Sacchrp_dh_NADP CoA_binding
Motif
Other DBs
NCBI-ProteinID: ADZ10592
UniProt: F0T6F8
Position
2419973..2420989
Genome map
AA seq 338 aa AA seqDB search
MKAVGINGYGTIGKRVADAVSAQDDMKIVGVTKRTPNFEAKRAVELGYDIYMSAPDRENL
FEEADIPVKGTINDLYDKVDVIVDCTPGGVGAKNMADYEKAGVKGIFQGGEKHDQIGRSF
NSFSNFKESVGADFTRVVSCNTTGLCRTLNPIKELAGINKVRAVMVRRGADPGQVNKGPI
NSIVPNPPTVPSHHGPDVQTVMKGLKITTMAILVPTTLMHQHNLMVELDSSVSVDDVLDV
LEKTPRVIPVEASSGLGSTAEIMEFAKDLGRPRGDLFEIAVWKESLNIVDNELFYMQAIH
QESDVVPENVDAIRAMLEMETDPQKSIAKTNKNMGIIG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttggaataaacggatacggtaccataggtaaaagagtagcagatgcagtt
tctgcacaggatgatatgaaaattgttggtgttacaaaaagaactccgaattttgaagct
aaacgggccgttgaactaggttacgatatttatatgagtgccccagatagggaaaatttg
tttgaagaggcagacattcctgttaaaggcacaattaatgacctttatgataaagtagat
gtgatagtagactgcacacccggcggagtgggtgctaaaaacatggcagactatgaaaag
gctggagtcaaaggaatatttcagggcggtgaaaaacacgaccagataggaagatccttc
aactcattttcaaacttcaaagaatctgttggtgcggactttacaagggtggtctcttgt
aacacaactggtttgtgtagaacattaaacccaattaaagaacttgcaggcataaataag
gtcagagcagtcatggtaaggcgtggtgcagatcctggacaggtaaacaagggtccaatc
aattcaatagtacctaacccgccaactgtgccttctcaccatggtccagatgtacaaact
gttatgaaaggactaaaaataaccacaatggcaattttggttccaacaacactcatgcat
cagcacaacctcatggttgaacttgattccagtgtcagtgtggatgatgttctagatgtt
cttgaaaaaactcctagggtaattcctgttgaagcttccagtggtttaggttccactgcg
gagatcatggagtttgcaaaggatcttggaaggcctagaggagatctgtttgaaatagct
gtctggaaggaatccctcaacatcgtggacaacgaactattttacatgcaggcaatacat
caagaatcggatgtggttcctgaaaatgttgatgcaatacgtgcaatgcttgaaatggaa
acagacccacagaaatccattgcaaaaaccaataaaaacatgggcataattggttaa

DBGET integrated database retrieval system