KEGG   Methanobacterium lacus: Metbo_2405Help
Entry
Metbo_2405        CDS       T01437                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mel  Methanobacterium lacus
Pathway
mel00020  Citrate cycle (TCA cycle)
mel00640  Propanoate metabolism
mel00660  C5-Branched dibasic acid metabolism
mel00720  Carbon fixation pathways in prokaryotes
mel01100  Metabolic pathways
mel01110  Biosynthesis of secondary metabolites
mel01120  Microbial metabolism in diverse environments
mel01130  Biosynthesis of antibiotics
mel01200  Carbon metabolism
Module
mel_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mel00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metbo_2405
   00640 Propanoate metabolism
    Metbo_2405
   00660 C5-Branched dibasic acid metabolism
    Metbo_2405
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metbo_2405
Enzymes [BR:mel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metbo_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp Succ_CoA_lig Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: ADZ10618
UniProt: F0T6I4
Position
complement(2448943..2450049)
Genome map
AA seq 368 aa AA seqDB search
MKIHEYIAKEIFKAEGIPVPASQMVKNSEDAHKAALEINKPVAIKSQILVGGRGKAGGIQ
FATDPDEARDVSSKILGSTVKGELVEMVLVEEKLSIESEFYVSVVLDRSAKKPLIMASSS
GGMEIEEVATETPEKIVKYYINSLDEFLPYQGREIAIKMGIPNELISKVGGIIWKLVQIF
DKYDATIAEINPLVLTKEGIIAADAKLDIDDDALYRQKKLVELENIKSGEFAYVKLDGNI
AVIGNGAGLTLSGMDMLKLYGGEPATFLDIGGGSSRENIAKALNIVISDPDVKTVFLNVL
GGITRADDVARGVLDVMKESERKIPLVIRLTGTNEEEGQKILKDAGVSFETSMEAAAQKA
VELCSTKN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaatacattgccaaggaaatttttaaagcagagggaatacctgtacct
gcaagccagatggttaaaaattcagaagatgcacacaaagctgcccttgaaataaataaa
cccgtggccatcaaatcacagatcctggtcggtggtagaggtaaggcaggaggaatacaa
tttgcaacagatccagatgaagcacgtgatgtttcctcgaaaattttaggttcaactgtt
aagggtgagttagttgaaatggttctggtggaagaaaaattgtccattgaatctgaattc
tacgtgagtgtagttctggatagatcagctaaaaaaccactcatcatggccagcagttcc
ggtggcatggaaatagaagaagttgccacggaaacacccgaaaaaattgttaaatattat
ataaatagtttagacgaatttttaccttatcaaggaagggaaattgccataaaaatggga
attcctaatgagctcatttccaaggttggtgggataatatggaaactggtacaaatattt
gacaagtacgatgcaaccatagcagagattaacccattggtactcaccaaggaaggaatt
atagctgcagatgctaagctggatattgatgacgacgccttatacaggcaaaaaaaactg
gttgaacttgaaaatatcaaatctggagaatttgcatacgtgaaactggatggaaacatt
gcagtgataggtaacggtgcaggattaaccctgagtggaatggatatgttaaaactttat
gggggcgaaccagccacatttcttgacataggtggcggatcatccagagaaaacatagca
aaagcactcaacatagtaatatcggatcctgatgttaaaacagtatttttaaatgtttta
ggtggaatcacaagggccgatgatgttgcaaggggagtccttgatgttatgaaagaatct
gaaagaaaaatacccctggtaattcgtttaactggaaccaacgaagaggaaggtcagaaa
attcttaaagatgcaggagtttccttcgagacatccatggaagcagcggcacaaaaggct
gttgaactctgtagcacaaaaaattaa

DBGET integrated database retrieval system