KEGG   Melaminivora sp. SC2-9: C6568_05985Help
Entry
C6568_05985       CDS       T05358                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mela  Melaminivora sp. SC2-9
Pathway
mela00480  Glutathione metabolism
mela00590  Arachidonic acid metabolism
mela01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mela00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C6568_05985
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C6568_05985
Enzymes [BR:mela01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C6568_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AVO48855
UniProt: A0A2R3QAN4
Position
complement(1268809..1269429)
Genome map
AA seq 206 aa AA seqDB search
MSVRALAPWCAAVSTLVALAPAAASQPAAGASPAAHAAQASQPTPANCPALLQHTFPRLQ
DESPQSLCQHAGKVVLVVNTASYCGFTYQYEGLEALYKKYKDRGLVVLGFPSNDFLQEKS
DNKDIADFCYNTYGVVFPMFARTAVRGSDANALYRQLAQATGKKPIWNFNKYLIDRSGRS
VTHYGSKVEPQDQAFVQQLEALLARR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccgtgccctggcgccgtggtgcgccgctgtctcgaccctggtggccctggcc
ccggccgccgcgtcccagcctgctgccggcgccagccccgccgcccatgcggcccaagca
tcgcagccaacgcctgccaactgcccggccctgctgcaacacaccttcccccgcctgcag
gacgaaagtccgcagtcgctgtgccagcacgcgggcaaggtcgtgctggtggtcaacacc
gccagctactgcggcttcacctatcaatacgaggggctggaggcgctctacaagaagtac
aaggaccgtggcctggtggtgctgggctttccgtccaacgacttcttgcaggaaaagagc
gacaacaaggacatcgcggacttttgctacaacacctacggggtggtcttcccgatgttc
gcgcgtacggccgtgcgcggctcggatgccaatgcgctgtaccggcagctggcgcaggcc
accggcaagaagccgatctggaacttcaacaagtatttgatcgaccgctccggccgctcg
gtcacgcactacggaagcaaggtcgaaccccaggaccaagcgtttgtgcagcagttggag
gcgctgctggcccgccgttga

DBGET integrated database retrieval system