KEGG   Melaminivora sp. SC2-9: C6568_07190Help
Entry
C6568_07190       CDS       T05358                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mela  Melaminivora sp. SC2-9
Brite
KEGG Orthology (KO) [BR:mela00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C6568_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11
Motif
Other DBs
NCBI-ProteinID: AVO49063
UniProt: A0A2R3QB98
Position
1517968..1518387
Genome map
AA seq 139 aa AA seqDB search
MPQYQFQVEVQPEYLPEQSAPGRGIHSFAYTITVTNTGSVPAQLIARHWTIVDAGGHVEE
VKGLGVVGQQPLLRPGESFQYTSGCRLRTASGTMHGSFFCVAENGERFDCPVPLFVLEAE
TPHGGSASMGGPPSGRVLH
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagtaccagttccaggtcgaagtgcagcccgagtacctgcccgagcaatcggcg
cctggccgcggcatccacagcttcgcctacaccatcaccgtcaccaacaccggcagcgtg
cccgcgcagctgatcgcgcggcactggaccatcgtcgacgccggcgggcatgtcgaggag
gtcaagggcctgggcgtggtcggccagcagccgctgctgcgccctggcgagtcctttcaa
tacaccagcggctgccgcctgcgcaccgccagcggcaccatgcacggcagctttttttgc
gtggccgaaaacggcgagcgcttcgactgcccggtgcctctgttcgtgctggaggccgag
acgccgcacggcggcagcgccagcatgggcggcccgccttctggccgggtgctgcattga

DBGET integrated database retrieval system