KEGG   Melaminivora sp. SC2-7: C7H73_14350Help
Entry
C7H73_14350       CDS       T05362                                 

Definition
(GenBank) cytidyltransferase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
melm  Melaminivora sp. SC2-7
Pathway
melm00760  Nicotinate and nicotinamide metabolism
melm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:melm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C7H73_14350
Enzymes [BR:melm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     C7H73_14350
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     C7H73_14350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like FAD_syn NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AVP58733
UniProt: A0A2P1NNZ4
Position
3127500..3128540
Genome map
AA seq 346 aa AA seqDB search
MHDIAILIGRFQPVHAGHLALLHAALARARRVIVIAGSAHQARSPKNPFTWQERQAMLHG
ALPADDAARVAVLPVRDYYDQARWVAAVRAAVAPHANTDARIALVGHFKDASSSYLAWFP
DWELVDLPRQGDMDATRIRDAWLGAAAGALDAALAPLAAQIPAPTLALLRAVAATPEYAE
LQQEWRMLRQYRAAWACAPYTPVFVTVDALVRCQGRVLLIRRAQAPGRGLMALPGGFIEP
RETLWRSCLRELAEETQCALPEARLHEALRDVAVFDHPDRSQRGRVISHVHYFDLGDAGP
LPAVQAADDASEAHWVPVAQLAGMEAQFHDDHFHILDHFLGLTQRG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacatcgccatcctgatcggccgcttccagcccgtgcacgcggggcacttggcg
ctgctgcacgcggcgctggcgcgcgcgcggcgggtcatcgtcattgccggctcggcgcac
caggcgcgcagccccaagaaccccttcacctggcaagagcgccaagccatgctgcacggc
gccctgcccgcggacgacgcggcgcgcgtggccgtgctgcccgtgcgcgactactacgac
caggcgcgctgggtcgccgccgtgcgcgcggccgtggcgccgcatgcgaacaccgacgcg
cgcatcgccctggtcgggcatttcaaggacgcgagcagcagctacctggcctggttcccc
gactgggaactggtcgatctgccgcgccagggcgacatggacgccacgcgcatccgcgac
gcctggctgggtgcagccgccggggcgctggacgctgccctggcgccgctggccgcacaa
atcccggcccccaccctggcgctgctgcgcgccgtggcggccacgcccgaatacgccgaa
ctgcagcaggagtggcgcatgctgcgccaataccgcgccgcctgggcctgcgcgccctac
acgccggtgttcgtgacggtggatgcgctcgtgcgctgccaggggcgggtgctgctgatc
cgccgcgcccaggcgcccgggcgcgggctgatggcgctgcccggcggctttatcgagccg
cgcgagacgctgtggcgctcatgcctgcgcgagctggccgaggagacgcaatgcgccctg
cccgaagcgcgcctgcacgaggcgctgcgcgacgtggccgtgttcgaccaccccgaccgc
agccagcgcgggcgcgtcatcagccatgtgcattatttcgacctgggcgatgccggcccg
ctgcccgccgtgcaggcggccgacgacgccagcgaggcgcactgggtgcccgtggcgcaa
ctggcgggcatggaggcacagttccacgacgaccacttccacatcctggatcacttcctg
ggtctgacgcagcgcggctga

DBGET integrated database retrieval system