KEGG   Methanoculleus marisnigri: Memar_0074Help
Entry
Memar_0074        CDS       T00477                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01130  Biosynthesis of antibiotics
mem01230  Biosynthesis of amino acids
Module
mem_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Memar_0074
Enzymes [BR:mem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Memar_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABN56009
UniProt: A3CRK9
Position
69444..70199
Genome map
AA seq 251 aa AA seqDB search
MILDDIVRSTRERLRDLDQSVVDPDPLPRRSLAAAIRTSSERHAVIAEVKYASPSRGRIH
EGCTPEAIAREFVAAGAAGLSVLTEPTYFSGSIENLARVRRAVSVPVLRKDFIVDERQLG
ETRALGADAVLLIARVLGNRLPAFVDSALALGLEPLVEVHDRDEMERALATNATLIGINN
RNLATMTIDLSTTVRLAGAARDAGRVVVSESGIMWPYDVRSLSRHCDAFLIGSALMSARD
RRKRLEGFVFA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgacgatatcgtcaggtcgacccgcgagcgcctccgggatctcgatcaatcg
gtcgtcgatcccgatcccctgccccgccggagcctcgcagcggcgatacgcacctcttcc
gagaggcacgcggtcatcgccgaggtgaagtacgcctccccgtcgcgggggaggatccac
gaaggctgcacgcctgaggcgatcgcccgggagttcgtcgccgccggggccgccggcctc
tcggtgctgaccgaacccacctacttttcggggagtatcgagaacctcgccagggtgcgg
cgtgcggtctctgtcccggttctccgcaaagacttcatcgtcgacgaacgccagctcggc
gagacccgggcgctcggcgccgacgccgtcctcctgatcgcccgggtgctcgggaaccgc
ctccccgcgttcgttgattcggcgctcgcgctcgggctcgagccgctcgtcgaggttcac
gatagggacgagatggagcgtgctcttgcgacgaatgcgaccctcatcgggatcaacaac
cgtaacctcgcgacgatgacgatcgatctctcgacgaccgtccgcctggcgggggcggca
cgcgatgcggggagggttgtggtctcggagagcggcatcatgtggccctacgacgtgcgg
agcctctcccggcactgcgacgcgttcctgatcgggtccgccctgatgtcggcccgcgac
cggcgcaaacgactggaggggttcgtattcgcgtga

DBGET integrated database retrieval system