KEGG   Methanoculleus marisnigri: Memar_0710Help
Entry
Memar_0710        CDS       T00477                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00010  Glycolysis / Gluconeogenesis
mem00020  Citrate cycle (TCA cycle)
mem00620  Pyruvate metabolism
mem00640  Propanoate metabolism
mem00650  Butanoate metabolism
mem00680  Methane metabolism
mem00720  Carbon fixation pathways in prokaryotes
mem01100  Metabolic pathways
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
Module
mem_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mem_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Memar_0710
   00020 Citrate cycle (TCA cycle)
    Memar_0710
   00620 Pyruvate metabolism
    Memar_0710
   00640 Propanoate metabolism
    Memar_0710
   00650 Butanoate metabolism
    Memar_0710
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_0710
   00680 Methane metabolism
    Memar_0710
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Memar_0710
Enzymes [BR:mem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Memar_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABN56643
UniProt: A3CTE3
Position
690883..691791
Genome map
AA seq 302 aa AA seqDB search
MAEVEQECELFSAGHRACGGCGPALAARLLLKATGKNAILVASTGCMEVFSTPYPETAWG
VPWIHSLFENAAAVASGIEASLKRQGRSEKVLCVCGDGATFDIGVLCISGAFERGHDITY
ICYDNEAYMNTGIQRSGATPYGASTTTSPAGKCSPGNVHPKKDMPAILAAHGAPYVATAS
IAYPNDFIKKVERAINTPGPCYIQVHTPCCTGWGFEAGETLNMGKLAIETGLWVNYELVN
GQVEKVKKVRRKPVEEYLTKQKRFRHLFKPARQDDMIASIQAIADVNAERFGVDIKQKES
SE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtagagcaggaatgtgaactcttctcggccgggcaccgggcgtgcggaggg
tgcggcccggcgcttgcggctcgccttctcctcaaggcaaccgggaagaacgccatcctg
gtagcatcgaccggctgcatggaggtcttctccacgccctacccggagaccgcctgggga
gttccctggatccattcgctcttcgagaacgccgcggcggttgcctccggcatcgaggct
tcgttgaagaggcaggggcgcagcgagaaggtcctctgcgtctgcggcgacggagccacg
ttcgatatcggagtgctctgcatcagcggcgctttcgagcggggccacgacatcacctac
atctgctacgacaacgaggcctacatgaacacgggcatccagcggtcgggcgcgacgccg
tacggcgcgagcaccacgacgagcccggcaggcaagtgctcgcctgggaatgtgcacccg
aagaaggacatgcccgcgatcctcgccgcacacggtgcgccgtacgtcgcgaccgcctcg
atcgcctacccgaacgacttcataaagaaggtcgagcgggcgatcaacacccccggcccc
tgctatatccaggtgcacactccctgctgcacgggatggggctttgaggccggcgagacg
cttaacatgggcaagctcgccatcgagacaggcctctgggtgaactacgagctggtcaac
gggcaggtcgaaaaggtgaagaaggtgcgacggaaaccggtcgaggagtatctcacaaag
cagaagcgcttccggcacctcttcaagcctgcccggcaggatgacatgatcgcgagcatc
caggcgatcgccgatgtcaacgccgagcggttcggggttgacatcaagcaaaaagaatcg
tcagaataa

DBGET integrated database retrieval system