KEGG   Methanoculleus marisnigri: Memar_0713Help
Entry
Memar_0713        CDS       T00477                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00260  Glycine, serine and threonine metabolism
mem00750  Vitamin B6 metabolism
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Memar_0713
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Memar_0713
Enzymes [BR:mem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Memar_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 ADK_lid
Motif
Other DBs
NCBI-ProteinID: ABN56646
UniProt: A3CTE6
Position
complement(692892..694097)
Genome map
AA seq 401 aa AA seqDB search
MYRLVCVHCGATYSPDQIIYTCNRCGHLLTVEYDLDGIDVSRDEWNRRPLSVWRYRELLP
VRGEPVSLQEGGTPLYHLKNIGKELGLSELYAKHEGMNPTGSFKDRGMTVGVSMACELGM
TTVACASTGNTSASLAAYAAKGGIPCVVLLPAGKVALGKIAQALMHGARVISIRGNFDRA
LEMVHELCISHGLYLLNSVNPYRLEGQKTIGFETIDQLGGEVPDRMVLPVGNAGNISAVY
KGLRELETLGFIDRLPMMTGIQAAGSQPVVKAIEQNLEVLVPESAPETVATAIRIGAPVN
AEKALVAIRATGGTAAAVTDEEILAMQRDLARKEGIGVEPASAASVAGIRKLAELGLIDK
DERIVCVVTGHLLKDPETVVRQCEPPTEIDADLPSLLSALR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtctcgtctgcgttcattgtggtgcaacctactcaccggaccagatcatctat
acgtgcaaccgctgcggacacctgctgaccgtcgaatacgacctggacggcatcgacgtc
tcacgcgacgaatggaaccggcgccccctttcggtctggcgctaccgcgaactcctcccg
gttcggggcgaaccggtctccctccaggaaggagggaccccgctctaccacttaaagaac
atcggtaaggaactgggcctctccgaactctacgcaaaacacgaggggatgaacccaacc
ggttcgttcaaggaccgggggatgaccgtgggcgtcagcatggcctgcgaactcgggatg
acgacggtcgcctgcgcgagcaccgggaacacctccgcaagcctcgctgcctacgcggcg
aagggaggaattccgtgtgtcgtcctcctgcccgcggggaaggtcgccctcgggaagatt
gcccaggcgctgatgcacggtgcccgggtcatctctatccgcggcaacttcgatcgggcg
ctcgagatggtacacgagctctgcatcagccacggcctctacctcttgaactcggtcaat
ccctaccggcttgagggacagaagacgatcgggttcgagacgatcgaccagctcggcggc
gaggtgcccgaccggatggttctccccgtaggaaacgcgggcaacatctccgcagtctac
aaagggctccgggaactcgaaaccctcggattcatcgaccggttgccgatgatgaccggc
atccaggctgccggctcacagccggtggtgaaggcgattgagcagaacctcgaggtgctg
gttccggagtccgcgcccgagacggttgcgaccgcgatacggatcggcgccccggtgaat
gcggagaaggcgctcgtcgcgatccgcgcgacgggcgggacggcggcggccgtgaccgac
gaggagatccttgccatgcagcgggatctcgcgaggaaggaaggcatcggggtcgaaccc
gcctcggcagcctcggtcgccggaatacggaaacttgccgaactcggcctgatcgataaa
gatgagcggatcgtctgcgtggtgaccggtcatctcttaaaagatcctgaaacagtggta
cgacaatgcgagccccccaccgagatcgacgcggacctgccctcgctgctctctgccttg
cgctga

DBGET integrated database retrieval system