KEGG   Methanoculleus marisnigri: Memar_0841Help
Entry
Memar_0841        CDS       T00477                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mem  Methanoculleus marisnigri
Pathway
mem00020  Citrate cycle (TCA cycle)
mem00640  Propanoate metabolism
mem00660  C5-Branched dibasic acid metabolism
mem00720  Carbon fixation pathways in prokaryotes
mem01100  Metabolic pathways
mem01110  Biosynthesis of secondary metabolites
mem01120  Microbial metabolism in diverse environments
mem01130  Biosynthesis of antibiotics
mem01200  Carbon metabolism
Module
mem_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mem00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Memar_0841
   00640 Propanoate metabolism
    Memar_0841
   00660 C5-Branched dibasic acid metabolism
    Memar_0841
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Memar_0841
Enzymes [BR:mem01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Memar_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABN56774
UniProt: A3CTS4
Position
complement(820179..821264)
Genome map
AA seq 361 aa AA seqDB search
MKLLEYEAKRVFAEYGIPVPKGVVIRAPEEVAAHLPDLGGGVVLKAQVDVGGRGKAGGVL
MADRATAAETARELFSREIKGVPVGEILAEERLAIEHEYYVSIAVDRSSRQPVVLFADAG
GVEIEKMAQEDESAVRRVVVSPLLRDIPPFLMRELLGGAPKELAPVINCLYHVFQGKDAM
LAEINPLVTTPRGVYAADAKLIVDDNALARQGIAVNRDLSEREREAEKHGFSYVELDGSI
GVIGNGAGLTMSTLDLIEFYNGRAANFLDVGGGADQERVMHAVRLVASMPGVNVIVVNLL
GGITRCDEVAKGIIAAGVTPTVIVRMAGTNEEEGRRLLAGCGYRMLESMDAAVKAAMEVS
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaactactggaatacgaggcaaaacgggtctttgcagagtacgggataccggtcccg
aaaggggtcgttatacgggcaccggaggaggtcgcggcacacctgccggacctcggcggc
ggtgtggtgctgaaggcgcaggtggacgtcggcgggcgcggaaaggccggcggcgtcctg
atggccgaccgcgcgacagcggccgagaccgcccgggaactcttctcccgggagatcaag
ggcgtcccggtcggggagatcctcgcagaggagcgactggcgatcgagcacgagtactac
gtcagcatcgcggtcgaccggtcgagcagacagccggtggtactcttcgcggacgccggc
ggggtggagatcgagaagatggcacaagaggacgagtccgccgtacggagagtcgtcgta
tcccctctcctccgggacatcccgccgtttttgatgcgggaactcctcggcggcgcgccg
aaggaactcgcccccgtcataaactgcctctaccacgtattccaggggaaggatgccatg
ctcgcggagatcaacccgctcgtgacgacgccgcggggggtctacgcggcggacgcgaag
ctgatcgtcgacgacaacgccctcgcccgccaggggatagcggtcaaccgcgacctctcg
gaacgcgagcgcgaggccgagaagcacggtttctcctacgtggaactggacgggagcatc
ggggtcatcggcaacggcgccgggctcacgatgtcgacgctcgacctcatcgagttttac
aacgggcgggcggcgaacttcctcgacgtcgggggcggcgccgaccaggagcgcgtgatg
cacgccgtcaggctcgtcgcgagcatgcccggggtgaacgtgatcgtcgtcaacctcctc
gggggcatcacccgatgcgacgaggtggcgaaggggatcatcgccgccggcgtcacgccg
acggtcatcgtccggatggccgggacgaacgaggaggaggggcggcgactgctcgccgga
tgcggctaccggatgctcgagagcatggatgccgccgtgaaagcggcgatggaggtctca
ctatga

DBGET integrated database retrieval system